SecReT6
Protein ID: 170022648
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0395
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]429095..431698 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1JJP9
KEGG IDypy:YPK_0395
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.50E-39, Aligned region: 222..299
AAA_2 [PF07724], Evalue: 7.50E-39, Aligned region: 602..763
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 31..72
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 222..334
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 537..564
AAA [PF00004], Evalue: 6.10E-19, Aligned region: 608..728
AAA_5 [PF07728], Evalue: 9.10E-15, Aligned region: 51..74
AAA_5 [PF07728], Evalue: 9.10E-15, Aligned region: 222..299
AAA_5 [PF07728], Evalue: 9.10E-15, Aligned region: 607..726
ClpB_D2-small [PF10431], Evalue: 3.60E-13, Aligned region: 769..843
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 50..50
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 254..300
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 489..549
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 577..648
AAA_16 [PF13191], Evalue: 2.90E-11, Aligned region: 673..701
AAA_22 [PF13401], Evalue: 3.00E-08, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 3.00E-08, Aligned region: 606..638
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 133..168
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 222..250
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 419..454
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 608..636
NACHT [PF05729], Evalue: 1.40E-06, Aligned region: 812..837
AAA_14 [PF13173], Evalue: 4.30E-05, Aligned region: 222..337
AAA_14 [PF13173], Evalue: 4.30E-05, Aligned region: 606..696
AAA_29 [PF13555], Evalue: 9.20E-05, Aligned region: 215..239
AAA_29 [PF13555], Evalue: 9.20E-05, Aligned region: 604..632
DUF258 [PF03193], Evalue: 0.0002, Aligned region: 188..239
DUF258 [PF03193], Evalue: 0.0002, Aligned region: 607..623
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 222..244
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 476..501
AAA_25 [PF13481], Evalue: 0.00023, Aligned region: 603..636
AAA_19 [PF13245], Evalue: 0.00035, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00035, Aligned region: 602..629
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 202..241
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 608..628
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 678..689
IstB_IS21 [PF01695], Evalue: 0.002, Aligned region: 216..246
IstB_IS21 [PF01695], Evalue: 0.002, Aligned region: 607..618
Sigma54_activat [PF00158], Evalue: 0.0051, Aligned region: 221..238
Sigma54_activat [PF00158], Evalue: 0.0051, Aligned region: 606..705
MobB [PF03205], Evalue: 0.0055, Aligned region: 222..246
MobB [PF03205], Evalue: 0.0055, Aligned region: 607..629
AAA_17 [PF13207], Evalue: 0.0057, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0057, Aligned region: 608..642
Protein Sequence: 867 a.a.     [Download]
>gi|170022648|ref|YP_001719153.1| type VI secretion ATPase [Yersinia pseudotuberculosis YPIII]
MIQIDLPTLVNRLNPIARHSLEAAAAHCVSQQEAEITVSQVLLQMISTPLCDVRLILSHAGVEEDELRES
LDQRVSGYQAITQAYPSFSPLLVEWLQDSWLLASTEMEHSQLRSGVMLLTLLLSPSRYLVPTANRLLSPI
NRELLRQNFANWTADSAETPRAEKGAEAGNGAEINGDSLLARYASNMTEQARNGELDPVLCRDTEIDLMI
DILCRRRKNNPIVVGEAGVGKSALIEGLALRIVDNQVPEKLRNSELMTLDLGALQAGAAVKGEFEKRFKG
IMAEIAQSTTPIILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPSAQEATIIMRGLRTVYEQAHGVLIDDEALQAAAVLSDRYISGRQLPDKAIDVLDTAAARV
AINLTSAPRQVSALKNELYHQGMEIEMLEREQRLSLSRPDERLSVLQQQRIEIEQQLIALNTGWEKQQHL
VQQIIALRAVLLAQEESATDEQVVNLTALSDELERLQQHQTLVSPHVDKSQIAAVIAEWTGVPLNRLSQS
ELAVVTELPSYLGQQIKGQETAIHCLHQHLLTARADLRRPGRPMGAFLLVGPSGVGKTETVLQIADLLYG
GRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAF
DKGELADGEGRIIDCKNIVFFLTSNLGYQTIVDHADEPALLNERLYPELSAFFKPALLARMEVVPYLSLG
METLQIIIHGKLNRLDTLLRQRFSADVVIEPEVIDEILLRATRAENGARMLESIIDGALLPPVSLLLLQK
VAAGTAISHIRIAVEGNVFTAQVEGAI
 
Nucleotide Sequence: 2604 bp     [Download]
>gi|170022262|ref|NC_010465.1|:429095-431698 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGATTCAAATTGACTTGCCCACACTCGTAAACCGCCTTAATCCCATTGCCCGCCATTCTCTGGAAGCGG
CGGCGGCGCATTGCGTCAGTCAGCAGGAAGCTGAAATTACGGTCTCCCAAGTGCTACTGCAAATGATCTC
CACACCATTATGTGATGTCAGGTTAATCCTGAGCCATGCGGGTGTTGAGGAGGATGAACTACGGGAGTCG
CTCGATCAACGTGTTTCAGGCTATCAAGCTATTACCCAGGCCTACCCGAGTTTTTCCCCATTACTGGTGG
AATGGTTACAAGACAGTTGGTTGCTGGCATCGACAGAGATGGAACACAGCCAACTCCGTAGCGGCGTGAT
GTTATTGACGTTATTGCTCAGCCCGTCGCGCTATCTGGTCCCCACGGCCAACCGGCTACTGTCCCCGATT
AACCGTGAGTTACTGCGTCAGAATTTTGCTAACTGGACGGCAGACTCAGCAGAAACACCGCGAGCAGAAA
AAGGGGCTGAAGCTGGCAACGGCGCAGAAATCAATGGTGACAGCTTGCTGGCCCGCTATGCCAGCAATAT
GACCGAACAGGCCCGTAACGGCGAATTAGACCCTGTGCTGTGTCGGGATACCGAAATTGATCTGATGATC
GATATTCTGTGCCGCCGCCGCAAAAATAACCCGATAGTGGTGGGTGAAGCGGGGGTAGGGAAAAGTGCGC
TGATCGAAGGTTTAGCCCTGCGTATCGTGGATAATCAGGTGCCAGAAAAACTGCGTAACAGCGAGTTGAT
GACGCTGGATTTAGGCGCGCTTCAGGCTGGTGCGGCAGTGAAAGGCGAATTTGAGAAGCGTTTCAAGGGC
ATCATGGCGGAAATTGCGCAGTCCACGACGCCAATTATCCTGTTTATTGATGAAGCACACACGCTGATCG
GGGCCGGTAACCAACAGGGCGGATTAGACATTTCCAATCTGCTCAAACCCGCTTTAGCGCGTGGTGAACT
GAAAACGATTGCGGCAACCACCTGGAGCGAATACAAAAAATACTTTGAAAAAGATGCTGCGCTGTCGCGC
CGTTTCCAGTTGGTCAAAGTTTCTGAACCCAGCGCGCAAGAGGCCACGATTATCATGCGTGGCCTACGTA
CAGTTTATGAACAGGCGCATGGCGTCCTGATCGATGATGAAGCATTGCAAGCTGCGGCGGTGCTCAGTGA
CCGCTATATTTCAGGGCGGCAGTTGCCAGATAAAGCCATCGACGTGTTAGATACCGCAGCCGCACGTGTT
GCCATCAATCTCACCTCTGCACCGCGTCAGGTTTCGGCACTGAAAAACGAACTCTACCATCAGGGGATGG
AAATCGAGATGCTGGAGCGGGAGCAACGCCTCAGCTTAAGCCGCCCGGATGAGCGGTTATCCGTTTTACA
ACAGCAGCGAATTGAGATCGAACAGCAACTCATTGCCCTGAATACCGGTTGGGAAAAGCAACAACATTTG
GTCCAGCAGATTATCGCACTGAGAGCGGTCCTGTTGGCACAAGAAGAGAGCGCCACAGATGAGCAAGTGG
TCAATCTGACAGCGCTGAGCGATGAGTTGGAACGGTTGCAACAGCACCAGACGCTGGTCTCGCCCCATGT
GGATAAGAGCCAGATTGCGGCGGTGATCGCGGAATGGACCGGTGTACCGCTAAACCGCCTTTCTCAGAGT
GAATTGGCAGTGGTCACTGAATTGCCCTCTTATCTGGGGCAGCAGATCAAAGGACAAGAGACGGCTATCC
ATTGCTTGCACCAACACTTGCTGACCGCAAGGGCGGATTTACGTCGCCCAGGTCGCCCAATGGGGGCTTT
CCTGTTGGTTGGGCCTAGCGGCGTGGGTAAAACGGAAACCGTGCTACAGATTGCCGACCTGCTCTATGGT
GGCCGCCAATATCTCACCACCATCAATATGTCCGAATTCCAAGAGAAGCATACCGTCTCGCGCCTGATTG
GTTCACCTCCGGGCTACGTCGGGTATGGTGAAGGCGGCGTACTGACCGAAGCTATTCGTCAAAAACCTTA
CTCGGTAGTGCTACTGGATGAAGTGGAAAAAGCCCACCCCGATGTGCTGAATCTGTTTTATCAGGCCTTC
GATAAGGGCGAGTTGGCGGACGGTGAAGGCCGCATCATCGATTGCAAAAATATCGTATTTTTCCTGACCT
CCAATCTGGGATACCAGACCATTGTTGATCATGCAGACGAGCCTGCATTGCTCAATGAACGGCTCTACCC
CGAGCTATCGGCATTCTTTAAACCTGCGCTACTGGCCCGCATGGAAGTGGTTCCTTATCTGTCGCTGGGC
ATGGAAACGCTGCAAATTATCATTCACGGCAAACTGAACCGTCTGGATACGCTGCTGCGCCAACGCTTTA
GTGCTGATGTGGTCATTGAACCTGAAGTGATCGACGAAATCCTGCTACGCGCGACCCGTGCCGAAAATGG
TGCGCGTATGCTCGAGTCGATTATCGACGGTGCGCTATTACCACCGGTTTCTCTGTTGTTATTACAGAAA
GTGGCCGCTGGCACCGCTATCAGCCACATTCGGATCGCGGTAGAGGGGAATGTGTTTACTGCACAGGTTG
AGGGAGCGATATGA
 Primer design