SecReT6
Protein ID: 170022653
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0400
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]438259..439566 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDB1JJQ4
KEGG IDypy:YPK_0400
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 1.20E-48, Aligned region: 90..154
DUF3702 [PF12486], Evalue: 1.20E-48, Aligned region: 282..429
ImpA-rel_N [PF06812], Evalue: 5.80E-22, Aligned region: 41..101
Protein Sequence: 435 a.a.     [Download]
>gi|170022653|ref|YP_001719158.1| ImpA domain-containing protein [Yersinia pseudotuberculosis YPIII]
MSDTPQHIIIKTGTDPRNRPEFNAIREEINKINHPARPEVNWGLIESLALTLFRTHGVDLQTAVYYTLAR
TQKNGLAGFTEGCELLAGMVVGQWDHLWPEQPQARSEILEWFNTRVSNQLRQHDFTRDDLRLVYRAERAL
QLLYDKLQQVELKRVPRIENLLYLMQNTAKKLESASDAAKAQQTAAPLKMPPMVYLSVPEAEPVRTAAPE
PAANIEVRSPPPETKRGAVLWGFGAGVLCSLLVATAVYVTQFKPLQQQMTVLATQPESAALLWLNRPDVA
TYGEQLSTLENLSPLFVLNTADQSVAMARQRWPSDPSQVAESQRWARLVEARIGLAGTDSSYFQLQQRLH
ALSEKLLEQERSRGSLTISYLKTAVYQMQTELNREIPLEELLRQLAVSADEHQPASPVLIKQIDDRWNAL
LSRYHHLTQQTNSAR
 
Nucleotide Sequence: 1308 bp     [Download]
>gi|170022262|ref|NC_010465.1|:438259-439566 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGAGTGACACCCCGCAACATATCATCATTAAAACCGGCACTGACCCACGGAACCGGCCGGAATTTAACG
CCATTCGTGAAGAGATCAACAAAATCAACCACCCGGCACGGCCAGAGGTCAACTGGGGTTTGATTGAATC
ACTGGCGCTGACCCTGTTCCGTACCCACGGCGTGGATTTGCAGACGGCGGTGTATTACACGCTGGCCCGC
ACCCAAAAAAATGGCCTGGCCGGTTTCACCGAGGGCTGCGAGTTGCTGGCCGGTATGGTGGTCGGCCAGT
GGGATCACCTGTGGCCGGAACAGCCGCAGGCACGCAGTGAAATACTGGAATGGTTCAATACCCGCGTCAG
CAATCAACTGCGTCAGCATGATTTTACCCGTGACGATCTTCGGCTAGTGTACCGCGCCGAGCGGGCCTTG
CAGTTGCTGTACGATAAATTGCAACAGGTTGAATTAAAAAGGGTACCGCGCATTGAAAACCTGCTGTACC
TGATGCAGAACACCGCCAAAAAACTCGAATCGGCCAGTGACGCGGCGAAGGCTCAGCAAACTGCGGCCCC
GCTGAAAATGCCGCCTATGGTCTATCTCTCGGTACCCGAGGCCGAGCCTGTCCGGACGGCAGCCCCTGAG
CCTGCGGCCAATATTGAGGTGCGTTCGCCCCCCCCGGAGACCAAACGGGGGGCGGTGCTGTGGGGCTTTG
GTGCCGGTGTCCTGTGTAGTTTACTGGTGGCGACTGCGGTTTACGTTACCCAGTTCAAACCGCTGCAACA
GCAAATGACGGTGCTGGCCACCCAACCGGAAAGCGCGGCATTGCTGTGGCTCAACCGCCCGGATGTCGCC
ACCTATGGTGAGCAACTGAGCACCCTGGAAAACCTCTCGCCCCTGTTTGTGCTCAATACCGCCGACCAGT
CGGTGGCGATGGCTCGTCAACGCTGGCCGTCCGATCCCAGTCAGGTGGCCGAAAGCCAGCGCTGGGCGCG
GTTGGTGGAGGCGCGTATCGGCCTGGCCGGTACCGACAGCAGCTATTTCCAGCTCCAGCAGCGCTTGCAT
GCGCTGTCTGAAAAATTACTCGAACAGGAACGTTCTCGGGGCAGTCTGACCATCTCCTATCTAAAAACAG
CAGTTTACCAGATGCAGACCGAGCTGAACCGGGAGATACCGCTGGAGGAGTTACTGCGCCAGTTGGCGGT
GTCCGCCGATGAACATCAACCGGCCTCGCCGGTCTTGATAAAACAAATTGATGACCGCTGGAATGCCTTA
CTCAGCCGTTATCACCACTTAACGCAGCAGACGAACTCTGCCCGTTAA
 Primer design