SecReT6
Protein ID: 170022654
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0401
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]439588..441810 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB1JJQ5
KEGG IDypy:YPK_0401
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-69, Aligned region: 134..431
Phage_GPD [PF05954], Evalue: 1.20E-69, Aligned region: 609..643
Phage_base_V [PF04717], Evalue: 2.00E-23, Aligned region: 471..563
Protein Sequence: 740 a.a.     [Download]
>gi|170022654|ref|YP_001719159.1| ImpA family type VI secretion-associated protein [Yersinia pseudotuberculosis YPIII]
MFAHDKANNNKAADKTGTVTPTHIVSPEAAPTVSGAQMTEIAGGIGDAVGGTAGKRINQAAEVAKTALDA
KAKVLDGGVTPLNLAAGGAGAGLPDSVAAALTRLVKQPSGLQFTLTAAGLPPQTFAVVDFTLSEMLSSPF
VLNVGLASADPAVDFAAVLDEDATLFIWREGVLQRSITGMVASFEQGDTGFHQTRYSMVIRPALWRTSLR
RNARIFQQASVEEIITTLLKENGINDFAFGFRHPHPVREFCVQYQESDFDFIQRLTAEEGIFYYFEFSAG
KNTVVYADDVGSLPKGASLPYNPNVAAQAQELSITTFTRSAQVRPAMVQLKDYTFKNPNWAAAFSEQSGE
LQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRNDANLGQGASNDFTLQPGQLFSLYNHPRSDLNHAW
QLLGIQHSGKQMQALEQASGDQGTVLFNHFSFIPHTQTWRPTPLAKPAMDGPQIAMVVGPPGEEIYCDEY
GRIRLQFLWDRYGQSNDNSSCWIRVTQPWAGQGWGMLAIPRIGQEVVVDFLHGDPDQPIVTGRTYHANNI
PPGSLPASKTQMAFRSKTHKGEGYNEMRFEDAKGGEGLFMHAQKDMTTMVLNDRKTDVTQDHSEHIGQDQ
SVTVVRNQSNTIQNDRRVEVTRDQQTEVGNDYQLVVKGEKKEFVTKIRYTEVHEDETLTVTKSIKIHAKQ
GDISISTPNAGITITHDGAIILQGKYIRLAADMIDLNPEE
 
Nucleotide Sequence: 2223 bp     [Download]
>gi|170022262|ref|NC_010465.1|:439588-441810 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGTTTGCTCATGATAAAGCTAATAATAATAAAGCCGCGGACAAGACCGGCACGGTGACGCCGACCCATA
TCGTCTCGCCGGAGGCCGCCCCAACCGTGAGTGGCGCTCAGATGACCGAGATAGCCGGGGGGATCGGGGA
TGCGGTGGGCGGCACTGCCGGTAAGCGCATCAATCAGGCCGCCGAGGTGGCTAAAACTGCCCTGGATGCC
AAGGCAAAAGTACTGGACGGCGGCGTCACGCCGCTGAATCTGGCCGCGGGCGGGGCCGGGGCGGGATTGC
CGGACAGCGTGGCGGCGGCGCTTACCCGCCTGGTCAAACAGCCCTCAGGCCTGCAATTTACCCTGACGGC
GGCCGGTTTACCGCCCCAGACCTTTGCGGTGGTGGATTTCACCCTGAGCGAGATGCTCTCCTCGCCGTTT
GTGCTCAATGTCGGGCTGGCGAGTGCCGATCCGGCGGTGGATTTTGCGGCGGTATTGGATGAAGACGCCA
CGCTGTTTATCTGGCGAGAAGGGGTACTGCAACGCAGCATCACCGGCATGGTCGCCAGCTTTGAACAGGG
TGATACCGGTTTTCATCAGACCCGCTACAGCATGGTGATCCGCCCGGCGCTGTGGCGCACCAGCCTGCGG
CGCAATGCCCGCATCTTCCAGCAGGCCTCGGTGGAAGAGATCATCACCACCCTGCTGAAAGAGAACGGCA
TCAACGATTTTGCTTTTGGTTTTCGCCACCCGCACCCGGTGCGCGAGTTCTGCGTGCAATATCAGGAGTC
CGATTTTGATTTTATCCAGCGCCTGACGGCAGAAGAGGGGATTTTCTACTACTTCGAGTTCAGCGCCGGG
AAAAATACCGTGGTGTATGCCGATGATGTTGGCTCCCTGCCGAAAGGCGCGTCACTGCCCTATAACCCGA
ATGTGGCGGCGCAGGCGCAGGAACTGAGTATCACCACCTTCACCCGCAGTGCGCAGGTGCGCCCGGCGAT
GGTGCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGCCGCGGCCTTCAGCGAACAGTCGGGAGAA
CTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGGGC
AGGATTTTACCCGCTACCGGCTGGACGCACTGCGCAATGACGCCAATCTGGGGCAGGGGGCGAGCAATGA
TTTTACCCTCCAGCCGGGGCAGTTGTTCAGCCTGTACAACCACCCACGTAGTGACCTGAACCACGCCTGG
CAGTTGCTCGGTATTCAGCACAGCGGCAAACAGATGCAGGCGCTGGAGCAGGCATCTGGCGATCAGGGCA
CGGTGCTGTTCAACCACTTCAGTTTTATTCCGCACACCCAGACCTGGCGGCCGACGCCGTTGGCTAAACC
GGCGATGGACGGCCCGCAGATCGCCATGGTGGTGGGGCCACCGGGGGAAGAGATTTACTGCGACGAATAC
GGCCGTATCCGCCTGCAATTTTTATGGGATCGCTACGGGCAGAGCAATGACAACAGCTCCTGCTGGATCC
GGGTAACCCAGCCGTGGGCGGGCCAGGGCTGGGGCATGCTGGCCATTCCGCGTATTGGCCAGGAAGTGGT
GGTGGATTTTCTGCACGGCGATCCGGATCAACCGATTGTCACGGGGCGGACCTATCACGCCAACAACATC
CCGCCGGGGTCGTTACCGGCCAGTAAAACCCAGATGGCGTTCCGCTCAAAAACCCACAAAGGGGAAGGCT
ACAACGAAATGCGCTTCGAGGATGCCAAAGGCGGCGAAGGGCTGTTTATGCATGCGCAGAAAGATATGAC
GACCATGGTGCTGAATGATCGCAAAACCGATGTGACTCAGGACCATTCAGAGCACATTGGGCAAGACCAG
TCCGTGACGGTTGTGCGTAACCAAAGTAATACGATCCAAAATGATCGCCGGGTGGAGGTGACTCGCGATC
AACAAACCGAAGTGGGCAATGATTACCAGCTAGTGGTGAAAGGTGAAAAGAAAGAGTTTGTGACGAAAAT
TCGTTACACCGAAGTGCATGAAGACGAAACGCTCACGGTGACGAAAAGTATTAAAATCCATGCCAAACAA
GGTGATATCAGCATATCAACCCCGAATGCCGGAATTACGATCACCCATGACGGTGCCATTATTCTGCAAG
GGAAATACATTCGTTTAGCGGCCGATATGATCGATCTTAATCCAGAGGAGTAG
 Primer design

Protein ID: 170022665
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0412
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]452695..452916 [+]
Productputative rhs accessory genetic element
NoteTssI
UniProt IDB1JKB2
KEGG IDypy:YPK_0412
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 0.00024, Aligned region: 2..60
Protein Sequence: 73 a.a.     [Download]
>gi|170022665|ref|YP_001719170.1| putative rhs accessory genetic element [Yersinia pseudotuberculosis YPIII]
MVQLKDYTFKNPNWAVAFSEQSGELQNQRPDYEHFDFPGRFKDAQHGQDFTRYRLDALRKIIAEDQAWRY
HFQ
 
Nucleotide Sequence: 222 bp     [Download]
>gi|170022262|ref|NC_010465.1|:452695-452916 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGGTGCAACTGAAAGACTACACCTTTAAAAACCCGAACTGGGCCGTGGCCTTCAGCGAACAGTCGGGAG
AACTGCAAAACCAGCGACCGGACTACGAGCATTTTGATTTTCCGGGGCGCTTCAAAGATGCCCAGCACGG
GCAGGATTTTACCCGCTACCGGCTGGACGCGCTGCGCAAGATCATCGCGGAAGATCAGGCGTGGCGTTAC
CACTTCCAGTAG
 Primer design