SecReT6
Protein ID: 170022656
SecReT6 ID256
T6SS typei1
Gene symbol-
Locus tagYPK_0403
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]442267..446439 [+]
ProductYD repeat-containing protein
NotePAAR
UniProt IDB1JJQ7
KEGG IDypy:YPK_0403
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 365..391
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 401..437
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 474..499
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 488..524
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 531..567
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 595..619
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 638..671
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 662..695
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 701..730
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 722..757
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 766..796
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 808..823
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 865..901
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 919..937
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 939..953
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 992..1012
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 1024..1033
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 1059..1078
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 1066..1102
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 1086..1117
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 1135..1159
RHS_repeat [PF05593], Evalue: 6.70E-48, Aligned region: 1194..1216
RHS [PF03527], Evalue: 2.00E-21, Aligned region: 590..607
RHS [PF03527], Evalue: 2.00E-21, Aligned region: 1065..1073
RHS [PF03527], Evalue: 2.00E-21, Aligned region: 1180..1219
RHS [PF03527], Evalue: 2.00E-21, Aligned region: 1325..1348
PAAR_motif [PF05488], Evalue: 1.00E-11, Aligned region: 79..149
DUF4595 [PF15283], Evalue: 0.0079, Aligned region: 371..406
DUF4595 [PF15283], Evalue: 0.0079, Aligned region: 419..496
DUF4595 [PF15283], Evalue: 0.0079, Aligned region: 655..681
DUF4595 [PF15283], Evalue: 0.0079, Aligned region: 736..767
DUF4595 [PF15283], Evalue: 0.0079, Aligned region: 1001..1026
DUF4595 [PF15283], Evalue: 0.0079, Aligned region: 1058..1073
Protein Sequence: 1390 a.a.     [Download]
>gi|170022656|ref|YP_001719161.1| YD repeat-containing protein [Yersinia pseudotuberculosis YPIII]
MFEAARVDDKLYHSSALAGFIIGSIIGAAVIFAAAAYAASIVLTGGATLVATGFIVGMGVTTLGVVAGGL
IRSVGEKIGSMCHHDVGQITTGSKNVKVNSKRAAHVELSTVACKDDSAIQRMAEGSSNIFINSKAAVRLE
DKTTCDAVVDSASSNVTFGGGRVQYLDIKREISDEMRDLSEKLFIVAGLAGGIFGAAKQAGCFGLKCLSK
IALGEMAGAAAGYGLEKGVGAIAGYFGYPVDVISGQKLLTGEGDDTDFILPGIFPLHWSRIYRSENHHVG
ALGQGWSLVWERSLRKEDDSIVYQNDEGREIVFPLIKRGERYFSPTEHIWLARTERDTYAISSPFETCFI
FEAFSEAGVAKLASLEDLNGHALYFSYDDIGQLKKISTTSGYGVYCQYEKGRLVSVACVKGGTPGTLVRY
QYNEQHQLVSVTNREGQITRQFGYHGHLINKLADVRGLECRYTWADIGGTPRITHSATNLGEQWQFDYDI
DNQQTTLTDLNTGQTACWGYNAQHLITDYRDFDGGKYAFDYNDLNMPVRVVLAGERTLVLVYDALARPIQ
ITDPLKRETHIDYHRNSLRVVRRQYPDGQVWKGEYDRTGRLLKENAPDGGVTLYHYPGASSLPERITNAV
GAQTHLGWERHGQLTEHTDCSGKLTRYEYDIDGHLLTVIDAENHSTHYSYNRLGQPTGVRYADGRKEQLR
YNAQGLVEQFTDPVGRQLHWRYNLRGQPVSFTDRLQREYRYRYDCHGQMIELDNANGGQYHFRWSSGGQL
VEEQYPDNLVRRYRYGESGMLMALETTAPTVDDLTVSRQVSFDYDAGGRMTQRLTGMSATRYDWDIMDRL
LLAERVPTAVGEQAGIVGHGVRLAYDKAGHLLTESGDLGAVTYQWDPLHHLAALTLPDGQTLSWLRYGAG
HVSAIRHGDTLISEFSRDNLHREVSRTQGILTQYRDYDAMGRRLWQSAGSDAPTVAADLLPRQGDIWRKF
SFDTAGELSMATDFIRGEQQYRYDAEGRLTDSRERHQLSVAEDFAYDNADNLLNLRKLPFDTVDPLYDTP
VANNRLTQWQHYRFEYDAWGNITTRHAGGRMQHFAYDDDNRLLRAWGTGPLGEHDSHYRYDALGRRIHKS
VTIKRGAEKTTRQTDFIWQGLRLLQEQHADGNATYIYDPNESYTPLARVDQRHGETESQVYYFHTDINGT
PLDVTDGEGKHRWSGKYHAWGKVTRQNVSDPRQSTVSRFAQPLRYPGQYSDDETGLHYNTFRYYDPEIGR
FSTQDPIGLAGGVNLYQYGPNPLGWVDPWGLATYTSYEQARNAALKWLQDRGFKAETENLGRFGDIKGKP
VGMQTGNGKVGFRVEFDERSGAHINTWSGKEKGPHFQFEASEKTVKKIQKGFDKKTNGRC
 
Nucleotide Sequence: 4173 bp     [Download]
>gi|170022262|ref|NC_010465.1|:442267-446439 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGTTTGAAGCGGCCCGTGTTGATGACAAGCTTTATCATTCCAGTGCCTTAGCGGGTTTTATTATTGGCT
CCATTATTGGTGCCGCCGTGATTTTTGCGGCCGCGGCTTACGCCGCCTCCATTGTTCTCACCGGCGGGGC
GACGCTGGTCGCTACCGGCTTTATTGTGGGTATGGGGGTGACCACGCTGGGCGTCGTTGCCGGTGGGTTA
ATACGCTCCGTGGGCGAAAAAATAGGGAGCATGTGCCATCACGATGTCGGACAAATTACGACAGGGTCCA
AAAACGTTAAAGTGAACAGTAAACGGGCGGCGCATGTCGAGCTCAGTACCGTGGCCTGTAAAGATGACTC
CGCCATTCAGCGCATGGCCGAAGGTTCGTCAAATATCTTTATTAACAGTAAAGCCGCCGTTCGTCTGGAA
GATAAAACGACCTGTGATGCGGTTGTCGATTCCGCTTCCAGCAATGTGACGTTTGGTGGGGGGCGCGTTC
AGTATCTCGATATTAAACGCGAGATTTCTGATGAAATGCGTGATTTGTCAGAGAAGCTGTTTATTGTCGC
CGGGCTGGCGGGCGGCATATTTGGGGCGGCAAAACAGGCGGGGTGTTTCGGCCTTAAATGCCTGAGCAAG
ATTGCGTTGGGTGAGATGGCCGGGGCGGCTGCCGGGTATGGGCTGGAAAAAGGGGTTGGGGCCATCGCCG
GTTATTTCGGTTACCCGGTTGATGTGATCAGTGGACAGAAATTGCTGACAGGTGAGGGCGATGATACCGA
TTTTATTCTGCCGGGTATCTTCCCGCTGCACTGGAGCCGGATTTATCGCAGTGAAAATCACCATGTCGGG
GCGCTGGGACAAGGCTGGTCTCTGGTATGGGAGCGTTCATTACGCAAAGAAGATGACAGCATTGTTTATC
AGAATGATGAAGGTCGGGAGATTGTCTTTCCCCTGATTAAACGTGGAGAGCGCTATTTCTCCCCCACGGA
GCATATCTGGCTGGCACGTACCGAGCGTGATACCTATGCCATCAGCAGCCCGTTTGAAACCTGTTTTATT
TTTGAGGCCTTTTCTGAGGCTGGCGTTGCGAAATTAGCCAGCCTCGAAGATCTCAATGGTCATGCCCTGT
ATTTCTCTTATGACGATATCGGGCAACTGAAAAAAATATCGACCACCAGCGGTTATGGGGTGTATTGCCA
GTATGAAAAAGGGCGTCTGGTGTCCGTTGCCTGCGTCAAGGGCGGTACGCCGGGCACACTGGTCCGCTAC
CAGTATAATGAACAGCACCAGTTGGTCAGCGTCACTAACCGTGAGGGGCAAATCACCCGCCAGTTTGGTT
ACCATGGCCATCTGATCAACAAACTGGCGGATGTCAGGGGGCTGGAGTGCCGTTACACATGGGCTGATAT
CGGCGGAACCCCGCGAATTACGCACAGTGCCACCAATCTGGGGGAGCAGTGGCAGTTTGATTATGATATC
GACAATCAACAGACCACCCTGACGGACCTCAATACCGGGCAGACCGCCTGCTGGGGATATAACGCCCAAC
ATTTAATTACCGACTATCGGGATTTTGATGGCGGGAAATATGCATTTGACTACAACGACCTCAATATGCC
GGTACGCGTTGTGCTGGCAGGCGAGAGAACGCTCGTTCTGGTTTACGATGCACTGGCGCGCCCGATCCAG
ATCACCGATCCGCTAAAACGTGAAACCCACATTGATTATCACCGTAACAGTCTGCGGGTGGTGCGCCGTC
AGTACCCTGACGGGCAGGTCTGGAAGGGGGAATATGACCGTACCGGCCGTTTGCTGAAAGAGAACGCGCC
GGATGGCGGGGTGACGCTTTATCATTATCCAGGGGCCTCATCCCTTCCTGAACGCATAACCAATGCCGTA
GGGGCGCAGACACACCTTGGTTGGGAAAGGCACGGGCAACTGACGGAGCACACCGACTGCTCGGGTAAAC
TGACCCGCTACGAATATGATATCGATGGCCATCTGCTGACGGTCATCGATGCTGAAAACCATTCAACACA
TTACAGCTACAACCGTCTCGGGCAGCCCACCGGGGTCAGGTACGCCGATGGCCGCAAAGAGCAGTTGCGG
TATAACGCTCAGGGGCTGGTTGAACAGTTTACCGATCCTGTCGGGCGGCAGTTGCACTGGCGTTATAACC
TGCGGGGTCAGCCGGTCAGCTTTACTGATCGTCTGCAACGGGAATACCGTTACCGCTATGACTGCCATGG
GCAGATGATTGAGCTGGATAATGCCAATGGTGGCCAGTATCACTTCCGGTGGAGCAGTGGCGGGCAATTG
GTGGAAGAGCAGTATCCCGATAACCTTGTCCGGCGTTATCGCTATGGGGAGAGCGGGATGCTGATGGCGC
TGGAGACCACCGCGCCCACGGTTGACGATCTTACCGTCTCCCGGCAGGTCAGTTTTGACTATGATGCGGG
CGGGCGAATGACGCAGCGCCTGACGGGCATGAGTGCGACCCGGTATGACTGGGACATTATGGACCGTTTA
TTGTTGGCCGAGCGTGTGCCAACGGCGGTGGGCGAACAGGCGGGGATCGTCGGTCATGGTGTTCGTTTGG
CGTATGACAAGGCCGGGCATTTACTGACGGAAAGCGGTGACCTGGGTGCGGTGACGTATCAGTGGGATCC
GCTGCATCATCTGGCCGCCCTGACGCTGCCCGATGGTCAGACGCTGTCATGGTTGCGTTACGGTGCGGGC
CATGTCAGTGCCATTCGTCATGGTGATACGCTTATTTCCGAGTTCAGCCGGGATAATCTTCATCGGGAAG
TGAGCCGGACCCAGGGTATTTTGACGCAGTATCGTGATTATGACGCGATGGGGCGGCGGTTGTGGCAATC
GGCGGGTTCTGATGCGCCGACAGTGGCGGCCGATCTGCTGCCCCGTCAGGGGGATATCTGGCGTAAATTT
AGCTTTGACACTGCCGGTGAACTGAGCATGGCCACCGATTTTATCCGGGGTGAGCAGCAGTACCGTTATG
ATGCGGAAGGGCGGCTGACTGACAGCCGGGAGCGTCATCAGTTATCCGTTGCGGAGGATTTTGCTTACGA
CAATGCGGATAACCTGCTGAACCTGAGGAAACTGCCGTTTGACACGGTCGATCCACTGTACGATACACCG
GTCGCCAACAACCGTTTGACGCAATGGCAGCATTACCGTTTTGAGTATGATGCCTGGGGAAACATCACCA
CGCGGCATGCCGGTGGTCGGATGCAACATTTTGCCTATGACGATGATAACCGGCTGCTGCGGGCCTGGGG
AACCGGGCCGTTAGGGGAGCATGACAGCCACTATCGGTATGATGCGCTGGGGCGGCGTATCCACAAATCG
GTGACGATAAAGCGCGGCGCAGAAAAAACCACCCGTCAGACCGATTTTATCTGGCAGGGGTTGCGGTTAT
TGCAGGAGCAACATGCGGACGGCAACGCGACCTATATTTACGACCCGAACGAAAGTTATACGCCGCTGGC
GCGGGTCGATCAGCGTCATGGCGAGACAGAAAGTCAGGTGTATTATTTTCATACGGATATCAACGGTACC
CCGCTGGATGTCACGGACGGAGAGGGTAAGCACCGCTGGTCAGGGAAATACCACGCCTGGGGCAAAGTTA
CCCGGCAGAATGTCAGCGATCCAAGGCAAAGCACGGTCAGCCGGTTCGCGCAGCCGCTGCGTTATCCGGG
GCAATACAGTGATGACGAGACGGGTTTGCACTACAATACGTTCAGGTACTATGACCCGGAGATAGGGCGA
TTTAGTACGCAGGACCCGATAGGGCTGGCGGGGGGGGTGAATCTTTATCAGTATGGGCCAAATCCGCTAG
GTTGGGTGGATCCTTGGGGCTTGGCTACATATACATCATATGAGCAAGCAAGAAATGCAGCTCTAAAATG
GCTACAAGATAGAGGGTTTAAGGCTGAAACTGAAAATCTTGGTCGTTTTGGTGATATAAAAGGCAAACCT
GTTGGAATGCAAACGGGCAATGGAAAAGTTGGATTTAGGGTCGAGTTCGATGAGCGAAGTGGGGCTCATA
TTAATACATGGTCAGGTAAGGAAAAAGGTCCTCATTTCCAATTTGAAGCAAGTGAGAAAACTGTTAAAAA
AATTCAAAAAGGATTTGATAAAAAAACGAATGGAAGGTGCTAA
 Primer design