SecReT6
Protein ID: 170024816
SecReT6 ID259
T6SS typei2
Gene symbol-
Locus tagYPK_2591
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]2847223..2850645 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDB1JQL7
KEGG IDypy:YPK_2591
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.70E-74, Aligned region: 83..122
IcmF-related [PF06761], Evalue: 2.70E-74, Aligned region: 418..736
IcmF-related [PF06761], Evalue: 2.70E-74, Aligned region: 1053..1096
DUF1215 [PF06744], Evalue: 2.40E-38, Aligned region: 859..980
Protein Sequence: 1140 a.a.     [Download]
>gi|170024816|ref|YP_001721321.1| ImcF domain-containing protein [Yersinia pseudotuberculosis YPIII]
MKRIALPIKKPEVWFWIVALLFLLAGAVLCWLVWQHPERVGLIPGTPQRDRWLTGLVVGTGILTLCALLS
YAGTRLSGRKHFDELRQQAQGDDAPLPEDNAQAGETSQGEPSRLKTRLRRRYGLFWRDKVRLLMVVGEPD
EIAALAPQLAEQGWLEGQCTVLIHGGSLQRPADETGLSEWRKLRRGRPLDGIVWAMTAAQSGTPQWMDNG
LRTLEKMGAALRYQPPVYLWQVCDSDWPQDSRTEQPVGAVFPAKATPEKVEQQLRALLPQLREQGMQQLS
IEPHHDFLLRLAQSLDQGDAARWRQRLTPWFTEYAARIPLRGLMFSLPDTSASAAQVHEKSWTVPASWQG
VLDDCRVARGRRVGLPWEQTLCYSLLALIVLWGVGSVVSFTVNRHQMVSAAQQAQQLAQSHAVSDQQLMA
LQALRNDIGRLQARVAQGAPWYQRFGLDHNAPLLEVLMPWYGQANNRILRDATAQSLYQKLSELAELPAN
SPQRAARAKTGYDQLKAYLMMARPEKADAVFYAQVMQTTEPTRAGVSPGLWQSLAPDLWQFYAQNLPAQP
DWKITADTGLISQVRQVLLGQMGQRNAESTLYENMLLSVRRNYADMTLMDMTGDTDAQRLFQTSESVPGM
FTRKAWDEQIQQAIDKTVASRREEIDWVLSDNRRAISEDISPEALKKRLTERYFTDFAGSWLSFLNSLHW
NEAHNLSDVIDQLTLMSDVRQSPLIALMNTLAWQGQTGQQNQALSDSLVKSAKALMNKDQAPAIDQSAGG
PVGPLDETFGPLLALMGKGDAQNRLSSDSSLSLQTLLTRVTRVRLKLQQVVNASDPQEMTQVLAQTVFQG
KSVDLTDTQEYGSLIAASLGEEWSSFGQTMFVQPLTQAWETVLQPSSASLNDQWKNAVVANWKSAFDGRY
PFAASKSDASLPMLAEFIRKDSGRIDSFLTRELGGVLHKEGTRWVPNKVNSQGLTFNPAFLAAINQLSQI
SDILFTDGSQGLRFELLARPVPNVVETNLAIDGQKLHYFNQMESWQSFRWPGETYKPGTMLTWTGVSSGA
RLYGDYQGTWGLIRWLEQAKQKKLDEGRYQLTFTTADKQPLQWILRTELGKGPLGLLQLRNFTLPAQIFL
IQHAPLAIADMSDDEDMAED
 
Nucleotide Sequence: 3423 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c2850645-2847223 Yersinia pseudotuberculosis YPIII chromosome, complete genome
GTGAAGCGCATTGCCTTACCGATTAAAAAGCCAGAAGTCTGGTTCTGGATTGTTGCCCTGCTGTTTTTGC
TGGCCGGTGCCGTGTTGTGCTGGCTGGTCTGGCAACACCCCGAACGGGTGGGGTTAATTCCGGGGACACC
GCAACGTGACCGTTGGCTGACGGGACTGGTGGTGGGAACGGGGATCCTGACCCTGTGCGCATTACTGTCG
TATGCGGGGACCCGGTTATCCGGCAGAAAACACTTTGATGAGCTACGGCAGCAGGCACAGGGCGATGATG
CGCCGTTGCCGGAAGACAACGCGCAGGCGGGAGAAACGTCGCAGGGTGAACCGTCCCGCCTAAAAACCCG
CCTGCGCCGCCGTTACGGTCTGTTCTGGCGCGACAAAGTCCGGCTGCTGATGGTGGTGGGTGAACCTGAC
GAAATCGCCGCGCTGGCCCCGCAACTGGCGGAGCAGGGCTGGCTGGAAGGGCAGTGCACGGTGCTTATTC
ACGGCGGCAGTTTACAACGTCCGGCGGATGAAACCGGGCTGAGCGAATGGCGAAAATTGCGCCGTGGCCG
CCCGTTGGATGGCATTGTCTGGGCGATGACCGCCGCGCAGAGTGGCACGCCACAGTGGATGGATAACGGC
CTGCGAACGCTGGAAAAAATGGGTGCCGCCTTGCGCTATCAACCGCCGGTGTATCTGTGGCAGGTCTGTG
ACAGCGACTGGCCTCAGGATTCGCGGACGGAGCAGCCGGTCGGGGCGGTGTTCCCGGCGAAGGCTACGCC
AGAAAAGGTGGAGCAGCAACTGCGTGCCCTGTTGCCTCAGTTACGTGAACAGGGAATGCAGCAGCTTTCC
ATCGAGCCGCACCATGATTTCTTGTTGCGTCTGGCGCAGTCACTGGATCAGGGCGATGCGGCTCGCTGGC
GGCAGCGTCTGACGCCGTGGTTTACCGAGTATGCCGCGCGTATTCCCCTGCGTGGGCTGATGTTCAGTTT
ACCCGATACCTCTGCATCGGCGGCGCAGGTACATGAGAAAAGCTGGACGGTACCGGCCAGTTGGCAGGGG
GTACTGGATGATTGCCGGGTGGCGCGTGGACGCCGTGTCGGGCTGCCGTGGGAGCAGACACTGTGCTACA
GCTTGCTGGCACTGATTGTCTTGTGGGGTGTGGGCAGCGTGGTGTCATTTACGGTCAACCGCCACCAGAT
GGTCTCTGCCGCACAACAAGCACAGCAACTGGCGCAATCGCACGCAGTATCCGACCAGCAACTGATGGCC
TTACAAGCCCTGCGAAATGATATCGGGCGCTTACAGGCCCGCGTGGCGCAGGGCGCGCCGTGGTATCAGC
GCTTTGGTCTGGACCATAATGCGCCGCTGCTTGAGGTCCTGATGCCGTGGTATGGTCAGGCCAACAACCG
TATTCTCAGGGATGCCACCGCGCAGAGCCTGTATCAGAAACTCAGCGAACTGGCGGAGCTGCCCGCCAAC
AGCCCGCAACGGGCAGCACGGGCAAAAACAGGCTATGACCAGTTAAAGGCTTATCTGATGATGGCCCGCC
CGGAAAAAGCCGATGCTGTATTTTATGCTCAGGTGATGCAGACCACCGAGCCTACACGGGCCGGTGTCTC
CCCCGGTCTGTGGCAGAGTCTGGCGCCCGACTTGTGGCAGTTTTATGCACAAAATCTGCCCGCTCAGCCG
GACTGGAAAATTACCGCGGATACCGGGTTGATCAGCCAGGTGCGGCAGGTGTTGCTGGGGCAGATGGGTC
AGCGCAATGCAGAAAGTACGCTGTATGAAAACATGCTGCTGTCGGTGCGCCGCAACTATGCCGACATGAC
GCTGATGGACATGACCGGCGATACCGATGCTCAGCGTCTGTTTCAGACCTCGGAATCCGTGCCCGGTATG
TTCACCCGCAAGGCCTGGGATGAGCAAATCCAGCAGGCGATAGATAAAACGGTGGCCTCCCGCCGCGAAG
AAATTGACTGGGTATTGAGTGATAACCGCCGGGCGATATCCGAAGATATCTCACCGGAAGCGCTGAAAAA
ACGCCTGACCGAACGTTATTTCACCGATTTTGCTGGCAGTTGGCTGAGTTTCCTTAACAGTTTGCACTGG
AATGAGGCGCATAACCTGTCGGATGTGATTGACCAACTGACCTTGATGAGTGATGTACGCCAGTCGCCGC
TGATTGCGCTAATGAACACGCTGGCGTGGCAAGGGCAGACCGGGCAGCAGAATCAGGCATTATCGGATTC
GCTGGTGAAGTCTGCCAAGGCGCTGATGAATAAAGACCAGGCTCCGGCGATTGACCAGAGTGCCGGTGGG
CCAGTAGGGCCACTGGACGAGACCTTTGGCCCGTTGCTGGCACTGATGGGCAAAGGCGATGCACAAAACA
GGCTGTCGTCGGACAGCTCGCTGAGCCTGCAAACGTTGCTCACCCGCGTGACCCGGGTGCGGCTTAAACT
CCAGCAGGTGGTCAATGCTTCGGACCCGCAGGAGATGACACAGGTGCTGGCCCAGACCGTTTTTCAGGGC
AAAAGTGTTGATCTGACGGACACGCAGGAGTACGGCAGCCTGATAGCCGCCAGTCTGGGAGAGGAGTGGA
GCAGCTTCGGGCAGACGATGTTTGTGCAGCCGCTGACGCAGGCGTGGGAAACGGTGCTGCAACCTTCATC
GGCCAGCCTTAACGACCAGTGGAAAAACGCGGTGGTGGCCAACTGGAAATCGGCCTTTGATGGCCGCTAT
CCGTTTGCCGCCAGTAAAAGTGATGCTTCATTGCCGATGCTGGCCGAGTTTATCCGCAAGGACAGCGGGC
GCATCGACAGCTTCCTGACCCGTGAACTGGGCGGCGTGCTGCACAAAGAAGGGACGCGCTGGGTGCCGAA
TAAGGTGAACAGCCAGGGGCTGACCTTTAACCCCGCCTTCCTGGCGGCAATTAATCAACTGAGTCAAATC
TCCGACATCTTGTTCACTGACGGCAGTCAGGGGCTGCGCTTTGAGCTGCTGGCCCGTCCGGTGCCGAATG
TGGTGGAAACGAATCTGGCGATTGACGGACAGAAATTGCATTATTTCAACCAGATGGAGAGCTGGCAGAG
TTTCCGCTGGCCGGGGGAGACCTATAAACCCGGCACGATGTTGACCTGGACTGGTGTGAGTTCAGGCGCC
CGGTTGTACGGTGATTATCAGGGGACATGGGGGCTGATCCGTTGGCTGGAGCAGGCAAAACAGAAAAAGC
TGGATGAAGGGCGCTATCAACTGACCTTCACCACCGCAGATAAACAGCCATTGCAATGGATATTACGCAC
CGAGCTGGGCAAAGGCCCGTTAGGCCTGTTGCAACTGCGTAATTTCACTCTGCCTGCGCAAATTTTTCTG
ATACAGCACGCGCCGCTTGCGATTGCTGACATGTCAGACGATGAAGACATGGCAGAAGACTGA
 Primer design