SecReT6
Protein ID: 170025765
SecReT6 ID260
T6SS typei3
Gene symbol-
Locus tagYPK_3550
StrainYersinia pseudotuberculosis YPIII
Repliconchromosome [GenBank: NC_010465] [Browse all T6SS(s) in this replicon]
Location [Strand]3905709..3909203 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB1JKW0
KEGG IDypy:YPK_3550
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.00E-75, Aligned region: 498..796
DUF1215 [PF06744], Evalue: 5.20E-30, Aligned region: 905..1024
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 95..114
ImcF-related_N [PF14331], Evalue: 3.60E-29, Aligned region: 194..375
Protein Sequence: 1164 a.a.     [Download]
>gi|170025765|ref|YP_001722270.1| type VI secretion protein IcmF [Yersinia pseudotuberculosis YPIII]
MIRRMLILIIALVLCYIVWWIGPLIAIGPYFPLGGVWVRKIIIALILFWALWPFVAIFFSWIFRYARAPL
PKRKKKTVQLDRVSARFHDAMLTLQHADLSSQKTRWQRWRQRRKRQYIDAKPWFLVMGPPGCGKTSIVYE
SSEKFLLSEQYGLAQTTDIGPTQDCNWWLTDRAVYIDTAGEWILLHGQSEEAGTARQKLFSMIRKYRRYP
GVDGIVLCLDVSVLLNSSVTERKSLADTLRLRILEVASTFQADIAVYLFLNNIDKLPGGETFLSLMNDEL
LAGGLGISMTHNEKGQNNFVADEERYRELLTRVSRYVLEILHDSPNMEMRHQLLLFTESLGALQKPLFGL
FEQIFPATPIGYTGCLRQFWFGSTQNLTSWEALYYPSSTSTFESRPAGQMYFPALSQAITERGVLHATGP
MPLRNRLLNIGKYVFVVLVLCILLLMLSARYFWEYDYIGYATARFEETRRIVRDIPITNQVNDNLVAAYE
QLGYINTHYLESSPPLLTPYFEHRLLNQAMLQTYHRHLNKVFWPAVQNYVTNELKKDTQSPDGDNYDTLK
VYLMLGQPDHRSQEALVQWFMSRWESFAPQGYGQNDRKLFSYHLSELFSDTASAAPKVKLNDELIRESRI
KAMKTPIHIRVINRIHDAPLPARIEDLSLADAAGPSVTLMLRRKSPSTVTDLAIPAFYTRASYHDVVNPQ
LQEASEAMINEEAWVLSDGKASVSQVSLLAAAQKLSDEARKYYLMEYANQWDAFFNDIRVRPINGLDDAA
LLARQLSDPSSPLANLVRFSTREITLTTDNNGKGAMSSGWFNIQRNKLTTARRNIIDEMSGERSRFRLTP
EKAVEDRFELLRRLGYALQSASTSNSDPLGRTFEQIYNQLITLSTSLRAGQILPQNNDFSRLQIDMARQP
EPVRSIMMDLLAVGQTQSLQQSKANLSKGVSSIASDLCSNAVSGRYPFNRLASEEIGIGDFNRMFGRSGA
MQSFFDQNLAPYVDTNGNRWKVKPDSNGVVTPKTLRSFENSAQIRDTFFDASGKMAMSMIIRPISLTPSI
LEAVLDVDGQIINYSHGSNQPVKVDWPGPKGGVYIRLTFKTQDGNVETVSFNGPWAIFRMYDVSNPRPLG
VNSRELMMVMDNVSGVFKIELSSTMKDYPLWSKALAQFSCPKNL
 
Nucleotide Sequence: 3495 bp     [Download]
>gi|170022262|ref|NC_010465.1|:c3909203-3905709 Yersinia pseudotuberculosis YPIII chromosome, complete genome
ATGATACGCAGAATGTTGATTTTAATCATTGCCCTAGTGCTTTGTTATATTGTGTGGTGGATAGGGCCGC
TGATCGCCATTGGCCCCTATTTCCCTCTGGGGGGGGTATGGGTTCGTAAGATCATTATTGCTCTGATTTT
ATTTTGGGCACTGTGGCCATTTGTTGCAATTTTCTTCAGTTGGATTTTTCGTTATGCCCGTGCGCCACTT
CCCAAGCGCAAGAAAAAAACGGTTCAGCTTGATCGCGTTTCTGCACGTTTTCATGATGCGATGCTCACCC
TGCAACATGCGGATCTTTCAAGCCAGAAAACACGCTGGCAGCGCTGGCGTCAACGGCGTAAGCGCCAGTA
TATCGATGCTAAACCGTGGTTTCTGGTCATGGGGCCACCCGGATGCGGTAAAACGTCGATAGTTTATGAG
AGTAGCGAGAAGTTCCTACTCTCAGAACAGTATGGTTTAGCGCAGACCACGGATATTGGACCGACGCAGG
ACTGTAATTGGTGGCTGACGGATCGTGCTGTTTACATCGATACGGCAGGGGAATGGATCCTGCTGCATGG
TCAGAGCGAAGAAGCGGGCACGGCTCGGCAAAAATTGTTCTCTATGATCCGCAAATATCGCCGTTATCCG
GGGGTTGATGGGATTGTTCTTTGCCTTGACGTCAGCGTGCTTTTGAACTCTTCGGTGACGGAACGTAAGT
CACTGGCTGATACGTTGCGTCTGCGGATCCTGGAAGTTGCCTCGACATTTCAGGCCGATATTGCGGTGTA
CTTGTTCCTCAACAATATCGATAAGTTACCTGGCGGCGAAACCTTCCTCTCGCTAATGAACGACGAACTT
CTGGCCGGAGGGCTTGGGATTAGCATGACCCATAATGAAAAGGGTCAGAACAATTTCGTTGCCGATGAAG
AACGTTACCGTGAACTCCTGACACGTGTTAGCCGTTATGTGTTGGAAATACTGCACGATTCGCCCAATAT
GGAGATGCGCCACCAATTGCTGCTGTTTACAGAAAGCCTGGGAGCGCTACAAAAACCCCTGTTTGGCTTA
TTCGAACAAATATTTCCGGCGACACCGATTGGCTATACCGGTTGTTTGCGGCAGTTCTGGTTTGGCAGTA
CCCAAAATCTGACCTCATGGGAGGCGCTGTATTATCCGTCATCGACCAGCACCTTTGAAAGCCGGCCTGC
TGGGCAGATGTATTTCCCTGCACTGAGTCAAGCGATCACCGAAAGGGGGGTATTACACGCCACCGGCCCA
ATGCCTCTGCGAAATCGCCTGTTAAACATCGGTAAGTATGTGTTCGTGGTCCTTGTGCTCTGCATCTTAT
TGTTGATGCTGAGCGCCCGCTATTTTTGGGAATATGACTATATTGGCTATGCGACAGCTCGGTTTGAGGA
AACCCGTCGGATTGTGCGTGACATCCCAATCACGAATCAGGTCAACGATAATCTGGTCGCAGCTTACGAA
CAGTTGGGGTATATCAACACCCATTATCTGGAAAGTTCACCGCCACTGCTGACACCGTACTTCGAGCACC
GTTTACTGAATCAGGCGATGTTGCAAACCTACCATCGTCACCTGAATAAAGTGTTCTGGCCTGCGGTACA
AAACTACGTCACCAACGAGCTGAAAAAGGACACTCAATCTCCTGACGGTGACAACTATGACACGCTGAAA
GTTTACCTGATGCTCGGACAACCTGATCACCGCTCTCAGGAGGCATTGGTGCAATGGTTTATGTCGCGCT
GGGAAAGTTTTGCGCCTCAGGGATATGGGCAAAACGACCGCAAACTCTTCAGTTATCATTTGAGTGAACT
GTTTTCTGACACCGCCTCAGCTGCCCCGAAAGTTAAGCTGAATGATGAGCTGATCCGTGAATCACGCATT
AAAGCGATGAAAACACCGATACACATCCGGGTGATTAATCGTATTCATGACGCCCCACTGCCCGCGAGGA
TTGAGGATCTTAGTCTGGCTGATGCCGCCGGTCCTAGCGTAACACTGATGCTGAGACGTAAAAGCCCCAG
TACAGTAACGGATTTGGCGATCCCGGCTTTCTACACTCGGGCCAGCTACCACGATGTGGTTAACCCACAA
CTTCAGGAAGCATCGGAAGCGATGATTAACGAGGAAGCGTGGGTGTTGAGTGACGGTAAAGCTTCGGTTA
GTCAGGTTAGTTTACTGGCTGCTGCGCAAAAACTGTCCGATGAAGCGCGCAAGTATTATCTGATGGAGTA
TGCCAACCAATGGGATGCATTCTTCAATGATATCAGGGTGCGCCCAATCAACGGACTTGATGATGCGGCG
CTGCTGGCAAGACAACTCTCAGACCCGTCATCCCCGTTGGCTAATCTGGTGCGTTTCTCCACACGTGAAA
TAACCCTGACCACTGACAACAATGGTAAAGGGGCGATGTCGTCAGGCTGGTTCAATATTCAACGTAATAA
GCTCACGACTGCCCGCCGTAACATCATTGACGAAATGTCGGGTGAGCGTTCTCGTTTTCGTCTAACGCCA
GAGAAAGCGGTGGAGGATCGCTTTGAACTATTAAGACGTCTGGGATATGCCCTGCAAAGTGCGTCTACCA
GCAATTCTGATCCGTTGGGCCGAACCTTCGAGCAGATTTATAACCAGTTGATAACACTCTCGACTTCCCT
TCGGGCTGGGCAGATTTTGCCGCAAAATAACGATTTCAGTCGCTTGCAAATCGATATGGCCCGTCAGCCA
GAGCCGGTGCGCAGCATTATGATGGATCTGCTGGCCGTCGGACAAACGCAAAGTCTGCAACAAAGTAAGG
CCAACCTCAGCAAGGGCGTCTCTTCAATTGCTTCTGATTTATGTAGCAACGCCGTCAGTGGCCGTTATCC
CTTTAATCGGTTGGCTAGCGAAGAGATAGGTATTGGCGATTTCAACCGTATGTTTGGTCGTTCTGGGGCG
ATGCAAAGCTTCTTTGATCAGAATCTCGCACCGTATGTCGATACCAACGGCAACCGCTGGAAGGTAAAAC
CTGACAGTAACGGTGTGGTGACCCCTAAAACTCTGCGTTCGTTTGAAAACTCAGCACAAATCCGCGACAC
CTTCTTTGATGCCTCCGGCAAGATGGCGATGTCGATGATCATTCGCCCTATCTCACTGACTCCATCAATT
TTGGAAGCGGTTCTTGATGTCGATGGCCAGATTATTAACTACAGCCATGGTTCTAACCAACCGGTAAAAG
TTGATTGGCCAGGACCGAAAGGTGGGGTGTATATCCGCCTGACGTTCAAAACTCAGGATGGAAATGTGGA
AACCGTTAGCTTCAATGGTCCGTGGGCTATTTTCCGCATGTATGACGTTAGTAACCCTAGGCCACTCGGG
GTCAATAGCCGTGAACTCATGATGGTGATGGATAACGTGAGTGGCGTCTTCAAAATTGAGTTGAGTTCCA
CCATGAAAGATTATCCGCTGTGGTCAAAAGCATTGGCACAGTTCTCATGTCCTAAGAATCTCTAA
 Primer design