SecReT6
Protein ID: 170721680
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2499
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2774090..2776585 [-]
ProductOmpA/MotB domain-containing protein
NoteTssM
UniProt IDB1J8G6
KEGG IDppw:PputW619_2499
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.20E-66, Aligned region: 83..112
ImcF-related_N [PF14331], Evalue: 1.20E-66, Aligned region: 189..451
OmpA [PF00691], Evalue: 1.60E-15, Aligned region: 720..811
IcmF-related [PF06761], Evalue: 2.40E-08, Aligned region: 71..103
IcmF-related [PF06761], Evalue: 2.40E-08, Aligned region: 323..360
IcmF-related [PF06761], Evalue: 2.40E-08, Aligned region: 498..636
Protein Sequence: 831 a.a.     [Download]
>gi|170721680|ref|YP_001749368.1| OmpA/MotB domain-containing protein [Pseudomonas putida W619]
MNKIKYYCLRYQPYLLGLAFFLAIFVVWALGRALGFASLHSLLAGIGVFLLLSAGYVLLLYRGAGQHHNL
EALLRDDADQAVLNATPADREEISLLRERLLQSIERLHSNKPRATPAKDALYALPWYLVIGQPAAGKSTM
ILQSGLNFPYAEREGARVAGLGGTRNCDWFFSSEAVLLDTAGRYMNSPEEAGKWRGFLQLLRQHRQRRPL
NGLIVSVSIADILHGSAEDQERVAKRLRERIQESCALLEVRLPIYLVFTKCDLIPGFTPFYRQLDDAARG
EVMGKTFSHKGYEQADWGQRFGKAMDELTGYWEQVASQQLMQQDIQVTRQNNAAYRFPLELAALKPRLQQ
FVDSLLRANPYQNAELLRGFYFTAALEADDALWGSHGQHVAERFALAHGQDRSGGNSQPAPLFINSLFRK
VIIPDQHLVAVYTSNRRERQRKAAWVGAASLAGLLLCSLWGWSYMNNRNTLDTMAAELAQAKREDQANPG
HYAPWHSLDRLRFWAAHYYQQHHDQAVPLGMRLGLYQGHAVEPVLRARYFATLQNVMLKPTADNLTRTLY
LLTTLKVYQRNTRELQPVTGVDSVEAEALPHDNRAQSIADFGKAALDTYVMLSPAQREKADPALLKARLP
DYWYPAIARHTGKRMDAAGGESPANQDYLYASRQIVFYSDQIREPDVPRILDNAFLMSSSRNYINSLLTQ
SLRSIETITLESDTLFAFARADFQSLKSEGQNQLSAIASKLLNTPNIGKIIISGHADQLGDAQGNLQVSR
QRAQTIRTYLVGKGVPAELVSAQGEGSRKPLVNCDMQQPRAQLIKCLEPNRRVEIEVRGLN
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2776585-2774090 Pseudomonas putida W619 chromosome, complete genome
ATGAACAAGATCAAGTACTACTGCCTGCGCTATCAACCTTACCTCCTGGGGCTGGCCTTCTTCCTGGCGA
TCTTCGTGGTGTGGGCCCTGGGCCGTGCCCTGGGTTTTGCCTCGCTGCACAGCCTGCTCGCGGGCATTGG
CGTGTTCCTGCTGCTGTCGGCGGGCTATGTACTGCTGCTTTACCGTGGCGCAGGCCAGCACCACAACCTT
GAGGCGCTGCTGCGTGATGACGCAGACCAGGCGGTACTCAACGCCACCCCGGCCGACCGCGAAGAAATCA
GCCTGCTGCGCGAGCGCCTGCTGCAGAGCATCGAGCGCCTGCACAGCAACAAACCACGCGCCACCCCTGC
AAAGGACGCCTTGTACGCCCTGCCCTGGTACCTGGTGATCGGCCAACCGGCCGCCGGCAAAAGCACCATG
ATCCTGCAGTCCGGGCTCAATTTCCCTTACGCCGAGCGCGAAGGTGCGCGGGTTGCAGGCTTGGGCGGCA
CGCGCAACTGCGACTGGTTCTTCAGCTCCGAAGCGGTGCTGCTGGACACCGCCGGCCGCTACATGAACAG
CCCCGAGGAAGCCGGCAAGTGGCGTGGTTTTCTGCAGCTGCTACGCCAGCACCGCCAGCGCCGGCCACTC
AACGGGCTGATCGTCAGCGTCAGCATCGCCGATATCCTGCATGGCTCGGCCGAAGACCAGGAGCGTGTGG
CCAAGCGCCTGCGCGAGCGTATCCAGGAAAGCTGCGCCCTGCTGGAAGTACGCCTGCCCATCTACCTGGT
GTTCACCAAATGCGACCTGATCCCAGGCTTCACACCCTTCTACCGCCAGCTGGATGACGCAGCGCGCGGT
GAGGTGATGGGCAAGACGTTCTCGCACAAAGGCTATGAACAAGCCGACTGGGGCCAGCGCTTCGGCAAGG
CCATGGACGAGCTGACCGGCTATTGGGAGCAGGTGGCGAGCCAGCAACTGATGCAGCAGGATATTCAGGT
AACCCGCCAGAACAATGCCGCCTACCGCTTCCCGCTCGAGCTGGCTGCGCTCAAGCCACGCTTGCAGCAG
TTCGTCGACAGCCTGCTGCGGGCCAACCCGTACCAGAACGCCGAACTGCTGCGTGGTTTCTATTTCACCG
CAGCGCTGGAAGCCGACGACGCCCTGTGGGGCAGCCATGGCCAGCATGTCGCCGAGCGTTTCGCCCTGGC
GCATGGCCAGGACCGTAGCGGGGGTAACAGCCAGCCGGCACCGCTTTTCATCAACAGCCTGTTCCGCAAG
GTGATAATCCCCGACCAGCACCTGGTGGCGGTGTACACCAGCAACCGCCGTGAACGCCAGCGCAAGGCCG
CCTGGGTGGGTGCCGCCAGCCTGGCGGGATTGCTGCTGTGCAGCCTGTGGGGCTGGTCGTACATGAACAA
CCGCAACACCCTCGACACCATGGCCGCCGAACTTGCCCAGGCCAAGCGCGAAGACCAGGCCAACCCTGGC
CATTACGCCCCTTGGCACAGCCTCGACCGCCTGCGTTTCTGGGCAGCACACTACTACCAACAGCACCACG
ACCAGGCCGTGCCGCTGGGTATGCGCCTGGGCTTGTACCAGGGCCATGCGGTCGAGCCGGTACTGCGTGC
GCGCTACTTCGCCACCCTGCAGAACGTGATGCTCAAGCCCACGGCAGACAACCTGACACGCACCCTGTAC
CTGCTGACCACACTGAAGGTCTACCAGCGCAATACCCGTGAGTTGCAGCCGGTGACCGGTGTCGACAGTG
TCGAGGCAGAAGCCCTGCCCCATGACAACCGTGCCCAGTCGATCGCCGACTTCGGCAAGGCAGCGCTGGA
CACCTACGTGATGCTGTCACCTGCCCAGCGGGAAAAGGCCGACCCGGCATTGCTCAAGGCCAGGTTACCG
GACTACTGGTACCCGGCCATCGCCCGCCACACCGGCAAGCGCATGGACGCCGCCGGCGGCGAAAGTCCTG
CCAACCAGGACTACCTGTACGCCAGCCGCCAGATCGTGTTCTACAGCGACCAGATCCGTGAACCCGATGT
ACCGCGCATCCTCGACAACGCGTTCCTGATGTCCAGTTCGCGCAACTACATCAACAGCCTGCTGACCCAG
TCGTTGCGCTCGATCGAAACCATCACGCTGGAGTCCGACACCCTGTTCGCCTTTGCCCGCGCCGACTTCC
AGAGCCTCAAGAGCGAAGGCCAGAACCAGCTGAGCGCTATCGCCAGCAAACTGCTGAACACCCCGAACAT
CGGCAAGATCATCATCTCGGGCCACGCCGACCAGCTCGGCGATGCCCAAGGCAACCTGCAGGTTTCCCGG
CAACGGGCGCAAACCATCCGCACCTACCTGGTCGGCAAGGGCGTACCCGCCGAGCTGGTAAGTGCACAGG
GCGAAGGCAGCCGCAAACCGCTGGTCAACTGCGACATGCAACAACCGCGGGCGCAACTGATCAAGTGCCT
GGAGCCCAACCGGCGGGTGGAAATCGAAGTGCGCGGGCTCAACTGA
 Primer design