SecReT6
Protein ID: 170721682
SecReT6 ID261
T6SS typei4b
Gene symbol-
Locus tagPputW619_2501
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]2777487..2781293 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB1J8G8
KEGG IDppw:PputW619_2501
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.90E-60, Aligned region: 181..433
IcmF-related [PF06761], Evalue: 4.60E-43, Aligned region: 261..305
IcmF-related [PF06761], Evalue: 4.60E-43, Aligned region: 491..554
IcmF-related [PF06761], Evalue: 4.60E-43, Aligned region: 631..876
DUF1215 [PF06744], Evalue: 6.10E-24, Aligned region: 317..343
DUF1215 [PF06744], Evalue: 6.10E-24, Aligned region: 778..818
DUF1215 [PF06744], Evalue: 6.10E-24, Aligned region: 1010..1125
AAA_16 [PF13191], Evalue: 0.00035, Aligned region: 112..251
AAA_16 [PF13191], Evalue: 0.00035, Aligned region: 509..532
AAA_16 [PF13191], Evalue: 0.00035, Aligned region: 885..936
Protein Sequence: 1268 a.a.     [Download]
>gi|170721682|ref|YP_001749370.1| type VI secretion protein IcmF [Pseudomonas putida W619]
MKTLLRLLKSFWILLPLLWLVTLLICWLVAPMVPWLRHHVPEALAIISACFLLVIVLRQYQRIRAEHNLE
NLLQIEVDRSWNATGEFRDQQVLRERLKHAIAMLRTDRSAGGGGKAALSDLPWYLVIGMSAAGKTSLLTH
SGLSASIATANDSESGTQHCDWYFSPDAVMIDTAGRYLRDDQSASEFSAFLRMLRKQRGKAAINGLVLVV
SLPELLAANSDGRNALAAQLVARVEEYAECLGTNPPVYLMLSKTDQLPGFNQAFEGLDLHQRQQPLGMTF
GLSEIRNNGLQAVLNTRLKNLQSHIRRHVDAQMISLGADADSTLLNFPQYFAELNGVLEQFLEHFTRGQG
GGAPLLLRGLYFTSALQTEQQLGQVYDDVIADNFALQAAHDEGAQPASHTQGNRSYFITDTFRQVIFPDR
DLTLYQSRLGRKAGFSPLLLGLAAAAGVAFIGWQALSFANNRQWLDSLRGQLAEIERADDRAQLLAAGKG
LEVLRGQMATVEAHRQQGVPLQLSAGLYHGEAIHQVARDAYLAQLRSQALEPIARSLQVQMRAFNTFASG
INQELEFTPAPKSRNGKPLTPRLAAKAQAALTKTRAGAYAAKVNLATASDAAELSATTGGLSLSEEMLGR
LDEQQVASIIEAYNTLKLYLLLTEPQAHPDPAFVAASLPQAWAGAATQGSPADAAVISENAPLYVQLLEQ
GQAPSLPRNQQLIDETRQNLKAFMISSSLVDREYLRLQLESSRQFPALSLNDLVPTPGRNLLYSSAGVPA
IYTRQGWDTFVKPELIKLVSGNLRNESDWVLDGEGGDAIVQKANFVREFMARYKRDYTQAWYKMVSSVGV
RHFADLASATEHLGLLSDVQNSPVKNLLAAVNDNTQWDLPVKRDTTPTGNARADGFWSKVTGLIDEAKDV
APEALAPSLPAVDDGSLAKRFEPVARVFAANNAEGADSTIMDRYLAALRKLKVRMNNIQRSQDVGKSSKQ
LISETLEGQPSEVTTVRNYVETSVDTSQDGLSRSLQGLFSLPIQYAWETLRDPAGQQIAKAWKQQIAKPW
EQVMAHRYPIATGSRNEASVKDLQRFVDPESGLLPTFKRNEIGNLSGGEGLGLSNGKAPALVNPGMLNSI
DKASNVGQVIASLSDRDNGFEIMLEPSANFTDIVFTLDGQEQHYRNGRSSWSRFAWPGTNNTPGARLDVV
TLSGARITVFDFPGRWGLLRMNESARVDDLDGIQQRFSWNTANGRVSLVVRNFGGVKLTDLGDVKALSAL
NDAGRGAQ
 
Nucleotide Sequence: 3807 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c2781293-2777487 Pseudomonas putida W619 chromosome, complete genome
ATGAAAACATTACTGCGTCTGTTGAAGAGTTTCTGGATTCTCCTGCCACTGCTGTGGTTGGTGACCCTGT
TGATCTGCTGGCTGGTGGCACCGATGGTGCCCTGGCTGCGCCACCATGTGCCCGAAGCGCTGGCCATCAT
CAGCGCCTGCTTCCTGCTGGTGATCGTGCTGCGCCAGTACCAGCGCATCCGCGCCGAGCATAACCTGGAG
AACCTGCTGCAGATCGAGGTCGATCGCTCGTGGAACGCCACCGGTGAATTCCGCGACCAGCAAGTGCTGC
GCGAGCGCCTCAAGCATGCCATCGCCATGCTGCGCACCGACCGCTCCGCCGGTGGCGGTGGCAAGGCGGC
CCTGTCCGACCTGCCCTGGTACCTGGTGATCGGCATGTCGGCTGCAGGCAAAACCTCGCTGTTGACCCAC
TCGGGCCTCTCGGCCAGCATCGCCACCGCCAATGACAGCGAAAGTGGCACCCAGCACTGTGACTGGTATT
TCAGCCCCGACGCAGTGATGATCGACACCGCAGGCCGTTACCTGCGCGACGATCAGTCTGCCAGCGAGTT
TTCAGCCTTCCTGCGCATGCTGCGCAAGCAACGCGGCAAGGCAGCGATCAACGGCCTGGTGCTGGTGGTC
AGCCTGCCTGAACTGTTGGCGGCCAACAGCGACGGCCGTAACGCGCTTGCCGCGCAGTTGGTGGCGCGCG
TGGAGGAATACGCCGAGTGCCTGGGCACCAACCCGCCTGTGTACCTGATGCTGAGCAAGACCGACCAGTT
GCCCGGCTTCAACCAGGCCTTCGAAGGCCTGGACCTGCACCAGCGCCAGCAGCCGCTGGGCATGACCTTT
GGCCTGTCGGAAATCCGCAACAACGGTTTGCAGGCGGTGCTCAACACTCGCCTGAAAAACCTGCAAAGCC
ACATCCGCCGCCACGTCGATGCGCAGATGATCAGCCTCGGCGCAGATGCCGACAGCACACTGCTCAACTT
CCCCCAGTACTTCGCAGAACTCAATGGCGTGCTGGAGCAGTTCCTTGAGCACTTCACCCGCGGCCAGGGT
GGCGGTGCCCCGCTGCTGTTGCGCGGCTTGTACTTCACCAGTGCGCTGCAGACCGAGCAGCAACTGGGCC
AGGTGTACGATGACGTCATCGCCGACAACTTTGCCCTGCAAGCGGCCCACGATGAAGGCGCCCAGCCGGC
CAGCCACACGCAGGGCAACCGCAGCTACTTCATCACCGACACATTCCGCCAGGTGATTTTCCCCGACCGC
GACCTGACCCTGTACCAGTCGCGCCTGGGCCGCAAGGCAGGCTTCAGCCCCCTGTTGCTGGGCCTGGCCG
CTGCCGCCGGGGTGGCCTTTATCGGCTGGCAGGCGCTATCGTTCGCCAACAACCGCCAGTGGCTGGACAG
CCTGCGTGGCCAACTGGCCGAAATCGAACGCGCCGATGACCGCGCACAGCTGTTGGCTGCCGGTAAAGGC
CTGGAAGTGCTACGCGGGCAGATGGCCACGGTCGAGGCCCATCGCCAGCAGGGTGTCCCGCTGCAATTGA
GCGCCGGCCTGTACCACGGCGAGGCTATTCACCAGGTGGCCCGCGACGCCTACCTGGCGCAACTGCGCAG
CCAGGCACTGGAGCCGATTGCCCGCAGCCTGCAGGTGCAGATGCGTGCGTTCAACACCTTTGCCAGCGGC
ATCAACCAGGAGCTGGAGTTCACCCCGGCGCCGAAAAGCCGCAATGGCAAACCGTTGACGCCTCGCCTGG
CGGCCAAGGCCCAAGCGGCCCTGACCAAAACCCGTGCCGGCGCCTACGCCGCCAAGGTCAACCTGGCCAC
GGCCAGCGACGCGGCCGAATTGTCCGCCACCACCGGCGGCCTGTCACTGTCAGAAGAGATGCTCGGACGC
CTGGACGAACAGCAGGTGGCGTCGATCATCGAGGCCTATAACACCCTCAAGCTGTACCTGCTGTTGACCG
AGCCACAAGCCCACCCGGACCCAGCCTTCGTCGCTGCCAGCCTGCCGCAGGCCTGGGCAGGCGCCGCAAC
CCAAGGTTCCCCCGCCGACGCAGCCGTCATCAGCGAAAACGCCCCTCTGTACGTTCAATTGCTGGAGCAA
GGCCAGGCGCCGTCGCTGCCGCGTAACCAACAGCTGATCGACGAAACCCGGCAGAACCTCAAGGCATTCA
TGATTTCCAGCTCGCTGGTGGATCGCGAATACCTGCGCCTGCAACTGGAGTCCAGCCGCCAGTTCCCGGC
GCTGAGCCTCAACGACCTGGTGCCAACGCCTGGCCGTAACCTGTTGTACAGCTCTGCCGGCGTGCCGGCG
ATCTATACCCGCCAGGGCTGGGACACCTTCGTCAAGCCCGAGCTGATCAAGCTGGTTTCGGGCAACCTGC
GCAACGAGTCGGACTGGGTGCTCGACGGCGAAGGCGGCGATGCCATCGTGCAGAAAGCCAACTTCGTGCG
CGAGTTCATGGCCCGCTACAAACGCGATTACACCCAGGCCTGGTACAAGATGGTCAGCAGCGTGGGCGTG
CGCCACTTCGCCGACCTGGCCTCGGCCACAGAACACCTTGGGCTGCTCAGCGATGTGCAGAACTCGCCGG
TGAAGAACCTGCTGGCAGCGGTCAATGACAACACTCAGTGGGACTTGCCGGTCAAGCGCGACACCACGCC
TACGGGCAATGCCCGCGCGGACGGCTTCTGGAGCAAGGTAACCGGCCTGATCGACGAAGCCAAAGACGTG
GCGCCTGAAGCCCTGGCCCCTAGCCTGCCGGCCGTGGACGACGGCAGCCTGGCCAAGCGTTTCGAGCCGG
TCGCCCGGGTGTTCGCAGCCAACAACGCCGAAGGCGCCGACAGCACCATCATGGACCGCTACCTGGCCGC
GCTGCGCAAGCTCAAGGTGCGCATGAACAACATCCAGCGCTCGCAGGATGTCGGTAAAAGCAGCAAGCAG
CTGATCAGCGAAACTCTGGAAGGCCAGCCGAGCGAGGTGACCACCGTGCGCAACTACGTGGAAACCAGCG
TCGACACCAGCCAGGACGGCCTGTCGCGTTCGCTGCAGGGCCTGTTCAGCCTGCCGATCCAGTACGCCTG
GGAAACCCTGCGCGACCCGGCCGGCCAACAGATCGCCAAAGCCTGGAAGCAGCAGATCGCCAAGCCCTGG
GAGCAGGTCATGGCGCACCGTTACCCGATCGCCACCGGCAGCCGCAACGAAGCTTCGGTCAAGGACCTGC
AGCGTTTCGTCGACCCCGAAAGCGGCCTGCTGCCGACCTTCAAGCGCAACGAGATCGGCAACCTGTCCGG
CGGTGAAGGGCTGGGCCTGAGCAACGGCAAGGCGCCGGCGCTGGTCAACCCGGGGATGCTCAACAGCATC
GACAAGGCCAGCAACGTGGGTCAGGTGATCGCCAGCCTGTCGGACCGCGACAACGGCTTCGAGATCATGC
TTGAGCCGTCGGCCAACTTTACCGACATTGTGTTCACCCTTGATGGCCAGGAGCAGCACTACCGCAACGG
CCGCAGCAGCTGGAGCCGCTTTGCCTGGCCAGGCACCAACAACACGCCGGGCGCACGCCTGGACGTGGTC
ACCCTCAGCGGTGCACGCATCACCGTGTTCGACTTCCCGGGGCGGTGGGGCCTGCTGCGCATGAACGAAA
GCGCCCGGGTCGACGACCTGGACGGCATCCAGCAGCGCTTCAGCTGGAACACGGCCAATGGCCGGGTCAG
CCTGGTGGTGCGCAACTTCGGCGGGGTCAAACTCACCGACCTGGGCGACGTCAAGGCGCTGAGCGCCCTC
AACGACGCTGGCAGGGGCGCACAATGA
 Primer design