SecReT6
Protein ID: 170722416
SecReT6 ID262
T6SS typei2
Gene symbol-
Locus tagPputW619_3247
StrainPseudomonas putida W619
Repliconchromosome [GenBank: NC_010501] [Browse all T6SS(s) in this replicon]
Location [Strand]3580163..3583507 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDB1JAM3
KEGG IDppw:PputW619_3247
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.50E-68, Aligned region: 414..714
DUF1215 [PF06744], Evalue: 4.50E-32, Aligned region: 836..955
Protein Sequence: 1114 a.a.     [Download]
>gi|170722416|ref|YP_001750104.1| ImcF domain-containing protein [Pseudomonas putida W619]
MQFKRARLLIVVLSFALLILVLAGVALWLYPSGLNFAFGSVQGWDLSVVLPGIAFLIVLVTVGGLVLARR
FGASSYHHLTEGGAQPVAEIRSKALHAFYGAAADSRPLSRMYLRQQYGWFWSRRVQVLLVVGEPAQVNAI
VPGLIERQWLSGRAVVLLYGGSLLSKPDTTLLDKWQQQFRWRGIDGVVWALSERQLDDAASMSASIHHLQ
EMSRYLGRQLPVHVWQICESHWDQSERGIEAVGGLLPTRRAIAHWEEHLGALQRSLREQGLAQMQVQIAH
DFLLRLARNLQVDGAARWYRLIESLSGSGSRGIQVRGVWFSLPVQRPELSTTIEHHWPEDPAWSGILNDR
SARARRLGWHPARVAYVSALGLASIWGIGLVLSFASNRAEVGQIAAAYSALQQPVAGTDTKQALGEMVRE
LSRLDYRSEHGAPWYQRFGLNRSQDLREAVWPLYTQANSQLLRDPAVSELEKRLKALVNLPPASPLRAKR
AQQTYAYLKAYLMLARPEKADAAFLVQTLGATEPALWTFYGEHLPEHPDWAIKADLRLIAQTRQVLLRAL
GQRNAESSLYQQVLDTAANHYPALGLQQMVGDTDASALFTSAEQVPGVFTRQAWEGQVRAAIEEAAQARR
EEIDWVLSDHPNDIAKALSPEQLRERLTTRYFQDYSSAWLSFLNSLRWRQGHGLSDVIAQLTLMSDVRQS
PLIALMNTLSYQGQAGFRGQALADSLIESAQKLVGQKAAPIVDQLPQTPSGPLDSTFGPLLSLLGKEADG
RMSDDRLSLQTFLTRVTAVRLKLQQVVTAPDPEAMIQVLAQTVFQGKGADLTDIQAYGNLIAASLGADWG
PAANTLFVRPLDQAWQQILLPSSAGLNRAWQRAIVDEWQGAFSGRYPFAATSSDASLPMLGQMIRADSGR
IEQFLAQQLMGLLRKEGSRWVADSRQSQGLRFNPDFLTAINQLSQLADVLYTDGGMGVSFELQGKPVRDV
VQTTFVLNGEKHHYFNQRESWQRFRWPGQGDHPGISLTWSSVHTGERLFADYQGTWGLIRLLEQANVMAL
DDGDSRFRVVLDAPDGLGLTWHLRTELGEGPLALLKLRGFSLPREIFLVEGRDTPQYSQNGGYE
 
Nucleotide Sequence: 3345 bp     [Download]
>gi|170719187|ref|NC_010501.1|:c3583507-3580163 Pseudomonas putida W619 chromosome, complete genome
ATGCAATTCAAGCGGGCGCGGTTACTGATTGTTGTGCTTTCCTTTGCACTACTGATTCTTGTGCTGGCGG
GAGTGGCACTTTGGCTTTATCCCTCAGGTTTGAACTTCGCGTTCGGTAGCGTTCAAGGGTGGGATCTGTC
AGTAGTATTGCCTGGGATCGCTTTTCTGATTGTGCTGGTTACTGTTGGGGGCTTGGTGCTTGCCCGTCGC
TTCGGTGCTTCCAGTTACCACCATCTCACCGAGGGCGGTGCTCAGCCAGTAGCAGAGATCCGATCCAAAG
CCTTGCATGCATTCTACGGCGCGGCTGCAGACAGCCGTCCCTTGAGCCGAATGTATCTTCGCCAACAGTA
CGGTTGGTTCTGGTCGAGAAGAGTACAGGTGCTGCTGGTGGTCGGCGAGCCTGCCCAAGTCAATGCCATT
GTCCCTGGTCTGATTGAACGACAGTGGCTGTCGGGACGGGCAGTTGTGCTTCTTTATGGTGGCAGTCTCC
TTTCTAAACCAGACACAACGCTGCTCGACAAATGGCAACAGCAGTTTCGCTGGCGCGGCATTGATGGTGT
CGTTTGGGCGCTAAGCGAACGCCAGCTCGACGATGCTGCTTCCATGAGTGCAAGCATTCATCATCTGCAG
GAGATGAGCCGTTATCTAGGCAGGCAATTGCCTGTGCATGTTTGGCAAATCTGTGAAAGCCACTGGGACC
AGTCGGAGCGTGGCATTGAGGCGGTCGGTGGCTTGCTTCCTACCCGACGAGCCATAGCTCACTGGGAGGA
GCATTTGGGTGCCCTGCAGCGCTCGCTGCGCGAACAAGGTTTGGCGCAGATGCAGGTCCAGATAGCGCAC
GACTTTCTTCTGCGACTTGCGCGTAACCTGCAGGTTGACGGTGCTGCACGATGGTATCGCCTGATCGAGT
CCCTCTCAGGAAGTGGCTCCCGAGGCATCCAGGTCCGTGGCGTGTGGTTCAGCTTGCCCGTTCAGAGGCC
AGAACTGTCGACGACAATCGAACACCACTGGCCCGAAGACCCAGCATGGTCCGGAATCCTCAACGATCGC
TCCGCCCGAGCCCGCCGACTGGGTTGGCACCCAGCCAGAGTCGCCTACGTTTCTGCGCTGGGCCTGGCTT
CCATCTGGGGCATCGGCTTGGTGTTGTCCTTTGCCAGCAACCGTGCCGAGGTCGGTCAGATCGCGGCGGC
CTACAGCGCGTTGCAGCAGCCTGTAGCAGGCACCGACACTAAACAGGCACTGGGCGAGATGGTGCGTGAA
CTCTCCCGCCTGGACTACCGATCAGAACACGGCGCACCGTGGTACCAGCGCTTTGGCCTGAACCGGTCGC
AAGACCTGCGTGAGGCAGTGTGGCCGCTCTATACGCAGGCCAATAGCCAGCTGCTCCGCGACCCCGCCGT
TTCGGAACTGGAAAAACGGCTCAAAGCGTTGGTCAACTTGCCTCCGGCGAGCCCCCTGCGCGCCAAGCGG
GCACAACAGACGTACGCCTACCTCAAAGCCTATCTGATGCTGGCGCGCCCGGAAAAGGCCGATGCCGCGT
TCTTGGTCCAGACCCTGGGCGCTACCGAACCGGCATTGTGGACGTTCTACGGCGAGCATCTGCCTGAGCA
CCCTGACTGGGCGATCAAGGCCGACCTCAGGTTGATCGCCCAAACGCGCCAGGTGCTGCTGCGTGCACTG
GGTCAGCGAAACGCTGAAAGCAGCCTGTACCAGCAGGTCCTCGACACCGCGGCGAACCACTACCCGGCGT
TGGGTTTGCAGCAGATGGTCGGCGACACCGATGCAAGCGCCCTGTTCACCAGTGCAGAACAGGTCCCCGG
TGTATTCACCCGCCAAGCGTGGGAAGGGCAGGTTCGTGCAGCCATTGAAGAGGCGGCGCAAGCGCGGCGC
GAAGAGATTGACTGGGTACTCAGCGACCACCCCAACGACATTGCCAAGGCGCTGAGCCCCGAGCAACTGA
GGGAGCGCTTGACTACCCGCTACTTCCAGGATTACAGCAGTGCCTGGCTGAGCTTCCTCAACAGCCTGCG
CTGGCGGCAGGGCCATGGCCTGAGCGATGTGATTGCACAGCTGACACTGATGAGTGATGTGCGTCAGTCG
CCATTGATTGCCCTGATGAACACGCTGAGTTACCAGGGCCAGGCAGGCTTCCGTGGCCAGGCCCTGGCCG
ATTCCCTGATCGAATCGGCACAGAAGTTGGTGGGGCAAAAAGCAGCGCCGATCGTCGATCAACTTCCCCA
AACGCCCAGTGGCCCGCTCGACAGTACCTTTGGCCCATTGCTATCGCTTCTGGGAAAGGAAGCTGATGGC
CGAATGAGTGATGACCGCCTGAGCTTGCAAACTTTCCTCACGCGGGTCACCGCTGTGCGCTTGAAGCTGC
AGCAAGTGGTCACTGCGCCCGACCCTGAGGCAATGATCCAGGTACTGGCGCAAACGGTGTTCCAGGGGAA
GGGCGCGGACCTGACCGATATCCAGGCCTATGGCAACCTGATCGCCGCCAGTCTTGGCGCCGACTGGGGG
CCAGCGGCCAACACGCTGTTCGTGCGGCCGCTGGATCAGGCCTGGCAACAGATTCTGCTGCCGTCGTCGG
CCGGCCTCAACCGGGCGTGGCAGCGCGCGATCGTCGATGAGTGGCAGGGCGCTTTCAGCGGCCGTTATCC
GTTCGCTGCCACCAGCAGTGACGCTTCATTGCCCATGCTGGGGCAGATGATTCGCGCTGACTCTGGGCGG
ATCGAGCAGTTCCTGGCTCAGCAGCTCATGGGGCTGCTACGCAAGGAAGGCAGCCGCTGGGTGGCCGACT
CGCGGCAAAGCCAGGGGCTGCGTTTCAACCCGGACTTCCTGACAGCGATCAATCAGCTCAGTCAGCTGGC
TGATGTGCTGTACACCGATGGGGGCATGGGTGTGAGCTTCGAGTTGCAAGGCAAACCTGTGCGTGATGTG
GTGCAAACCACCTTCGTACTCAATGGTGAAAAGCACCACTACTTCAACCAGCGAGAAAGCTGGCAACGCT
TTCGCTGGCCAGGGCAGGGCGACCATCCGGGCATAAGCCTGACGTGGAGCAGCGTCCACACCGGCGAACG
TCTATTTGCGGACTACCAGGGAACCTGGGGGCTGATTCGTCTGCTGGAGCAGGCCAATGTAATGGCGCTG
GACGATGGCGACAGTCGTTTTCGGGTCGTGCTGGATGCGCCGGATGGTCTGGGCCTGACCTGGCACTTGC
GAACGGAGTTGGGCGAAGGGCCGCTGGCACTGCTCAAGTTGCGCGGGTTCAGCCTGCCGCGAGAGATCTT
TCTGGTAGAGGGCCGGGATACCCCGCAGTACTCGCAAAATGGGGGTTACGAATGA
 Primer design