SecReT6
Protein ID: 170726858
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2512
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3066803..3068188 [-]
ProductPAAR repeat-containing protein
NotePAAR
UniProt IDB1KGS0
KEGG IDswd:Swoo_2512
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.30E-21, Aligned region: 4..43
PAAR_motif [PF05488], Evalue: 2.30E-21, Aligned region: 20..92
PAAR_motif [PF05488], Evalue: 2.30E-21, Aligned region: 427..436
DUF2974 [PF11187], Evalue: 1.60E-10, Aligned region: 237..371
DUF4150 [PF13665], Evalue: 0.00017, Aligned region: 22..45
DUF4150 [PF13665], Evalue: 0.00017, Aligned region: 64..84
Protein Sequence: 461 a.a.     [Download]
>gi|170726858|ref|YP_001760884.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MPKAARLGDSCAGHGCMPATPIIAGSGDVSINGKPAARKGDTVLLHACPCPNMPHGIHGRSISAGSSNVS
INGKPAARVGDAVGCGGSVAAGSGDVLIGDTPYKSPTHKCGENAVKDNTPLLAMAPMPILAAIKWGEPAN
QFITADSVVTTVKQRKARYQARKKLASSTANESDPKIKAASERLDFNNDSILRAEAAQYVYRVDENRRDP
AKYPLPEAPVGLEVLDTKTIPGLENAVVMSKKSGFGAAIFKSEINDATMLTYRGTNNGVTGKKDWKTNGA
QGIGKQTKQYDQAMHLARQVKRSLGKEVEIVGHSLGGGLAASAVGVTGIKGYSFNSAGLHENTVSRQGGL
KMEKIKGLIQSQSVDGEVLTLLQSNRGVVAPLLAGVGSALGGTVGTAIGGILGAAILNSGAAPEAPGNMR
ELKSIEGGNPVTRHGMDQVIAGIEAQKKQDITTLTQYHWGQ
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3068188-3066803 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGCCAAAAGCAGCTCGATTAGGGGATAGTTGTGCAGGCCATGGTTGTATGCCTGCAACGCCTATTATCG
CAGGCAGTGGTGATGTTAGCATTAACGGCAAGCCCGCTGCGCGTAAAGGTGACACGGTATTGCTGCATGC
TTGCCCCTGTCCAAATATGCCCCACGGTATCCATGGTCGCAGTATCTCTGCGGGGTCATCTAATGTTTCT
ATCAATGGTAAACCTGCTGCTCGTGTTGGTGATGCTGTGGGTTGTGGCGGCTCAGTTGCAGCAGGCAGTG
GCGATGTACTTATAGGTGATACCCCCTATAAATCGCCGACGCATAAATGTGGTGAAAATGCAGTTAAAGA
TAACACGCCGCTGTTAGCGATGGCGCCCATGCCGATTTTAGCGGCCATCAAATGGGGAGAGCCTGCTAAT
CAGTTCATCACCGCGGATTCTGTCGTTACAACGGTGAAGCAGAGAAAAGCGCGCTATCAGGCACGTAAAA
AGTTGGCAAGCTCCACAGCAAATGAAAGTGACCCTAAAATTAAAGCGGCCAGTGAAAGGTTAGATTTTAA
TAATGACAGTATTTTACGTGCTGAAGCGGCGCAGTATGTCTATAGAGTCGATGAGAACCGACGGGATCCT
GCAAAATACCCACTACCTGAAGCACCTGTTGGGCTTGAAGTACTTGATACTAAAACAATTCCCGGGTTAG
AAAATGCAGTGGTAATGAGTAAAAAATCTGGATTTGGTGCTGCCATATTTAAATCAGAAATAAATGATGC
CACCATGCTGACCTACCGAGGTACCAATAATGGTGTTACTGGGAAAAAAGACTGGAAAACTAATGGTGCT
CAAGGTATTGGTAAACAGACAAAGCAGTATGATCAGGCGATGCATTTAGCGCGGCAAGTTAAACGCTCTC
TAGGTAAAGAGGTTGAAATTGTAGGCCACTCTTTAGGTGGAGGCTTAGCAGCGAGTGCGGTCGGTGTGAC
AGGAATTAAGGGTTATAGCTTTAACTCGGCCGGTTTACACGAGAATACTGTTAGCCGTCAGGGAGGGTTA
AAGATGGAAAAAATTAAGGGGTTGATACAAAGCCAGTCCGTTGATGGTGAAGTGCTGACTCTACTACAGA
GTAATAGAGGTGTGGTTGCCCCATTATTAGCGGGTGTTGGCAGTGCTTTAGGTGGCACAGTGGGCACGGC
AATCGGTGGGATATTAGGGGCTGCGATTCTCAATAGCGGCGCCGCGCCAGAAGCTCCGGGTAATATGCGA
GAACTTAAAAGTATCGAAGGTGGTAACCCAGTTACCCGTCATGGTATGGATCAAGTGATTGCGGGGATCG
AGGCGCAGAAAAAACAAGATATTACTACATTGACGCAATACCACTGGGGACAATAA
 Primer design