SecReT6
Protein ID: 170726859
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2513
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3068198..3070246 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB1KGS1
KEGG IDswd:Swoo_2513
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.20E-67, Aligned region: 31..332
Phage_base_V [PF04717], Evalue: 5.80E-24, Aligned region: 371..462
DUF2345 [PF10106], Evalue: 0.00049, Aligned region: 537..646
Protein Sequence: 682 a.a.     [Download]
>gi|170726859|ref|YP_001760885.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MALLGSGLRFHFKAQSLADDSFDVLDFNFIESLSSPFEVKLTLLSRLDNLTPEAIVDQTGLMSWSQGESV
ERHVHGIVSQFSKGDSGHHHTQYNVTIVPALSRLKLRKNSRIFQQQNVLVIISTLLNEMGISDYAFSCDA
RFESEVREYCVQYSETDFEFISRLAAEVGLFYYFEHTQDVHTLIFCDSTSKLSGLKSPFPYNVLSGGVAE
NTFVNQFSYQHQIKPANISLKDYSFKKPQYSFLQSSKGQELKFQKPDYEHFDYPGRYKDDAAGVPITQVR
QEYLRRDAQVATGQSNILQAIPGFKFDLIEHNDRALNRDWILTSIEHTGEQGAAAEEANTQKPTRYSNQF
HAIPGNNPWQAEPNSKPLVTGPQIAIVVGPKNEEIFCDEFGRVKVQFPWDRYGESNEHSSCWVRVSQGWA
GGQYGMMAVPRIGHEVIVSFLEGDPDQPIITGRAYHTTNVTPYILPNHKTRTVIKTQSHKAEGFNELRFE
DEASREQIYVHGQKDMDMVINNIHREEIGYDQHLTVEHDKFELVKQHRHTTIGQDEIAQVGRDHQVLVGR
NLIHRVVGMVKRYIGGGIITQIDGASQTSIAASEEKIIGANQQIKVDNESYLKASKIVLEAGDELTIKGP
GGFIKIDSGGVTISGSKVKINEGGSPGTGTAPKAVKPEEPAKPSIPETADRR
 
Nucleotide Sequence: 2049 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3070246-3068198 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGGCGCTTTTAGGCTCCGGATTGCGGTTTCATTTTAAAGCGCAAAGCTTAGCTGATGATAGCTTTGACG
TGCTTGATTTCAATTTTATTGAAAGCTTATCGAGTCCTTTTGAAGTTAAGCTCACTCTGCTGAGTCGGCT
CGATAATCTGACCCCTGAGGCGATTGTTGATCAAACCGGTTTAATGAGCTGGTCGCAAGGGGAGAGTGTT
GAGCGACATGTTCATGGCATCGTCAGTCAGTTCAGTAAAGGTGACAGTGGTCATCATCATACTCAATACA
ATGTCACTATCGTTCCCGCTTTATCACGCCTGAAATTAAGAAAGAATAGTCGAATATTCCAGCAGCAAAA
TGTACTTGTCATCATCTCAACCCTGCTAAATGAGATGGGGATAAGTGATTACGCCTTTAGCTGTGATGCA
CGATTTGAATCTGAAGTACGTGAGTATTGTGTTCAATACAGTGAAACGGATTTCGAGTTTATCAGCCGTT
TAGCTGCGGAAGTGGGGCTGTTTTACTATTTTGAGCATACTCAAGATGTTCACACACTTATCTTCTGTGA
CAGCACAAGTAAATTGAGTGGCTTAAAAAGCCCATTTCCCTATAACGTGCTCAGTGGTGGAGTTGCCGAA
AACACCTTTGTTAATCAATTTAGTTACCAACACCAAATTAAGCCCGCTAATATCAGCTTAAAAGATTACA
GCTTTAAGAAGCCTCAATATAGTTTTCTGCAAAGCAGTAAGGGCCAAGAGCTCAAGTTTCAAAAGCCTGA
CTATGAGCATTTTGATTACCCTGGTCGCTATAAAGATGATGCTGCTGGGGTTCCTATTACACAAGTTCGT
CAAGAATATCTGCGCCGTGATGCTCAAGTTGCCACAGGGCAGAGTAATATTTTGCAGGCTATCCCAGGTT
TTAAGTTCGATCTCATTGAACATAATGACCGAGCGCTTAATCGTGACTGGATATTAACGTCGATTGAACA
CACTGGTGAGCAGGGGGCGGCAGCTGAAGAGGCAAACACACAAAAGCCCACACGTTACAGTAATCAATTT
CATGCAATCCCAGGTAATAACCCTTGGCAGGCTGAGCCAAACAGTAAGCCTTTGGTTACAGGTCCACAAA
TTGCCATTGTGGTTGGCCCCAAAAATGAAGAGATATTTTGTGATGAGTTTGGCCGAGTAAAAGTCCAGTT
CCCATGGGACAGATATGGAGAGAGTAACGAGCACTCCAGCTGCTGGGTTCGAGTCAGTCAAGGTTGGGCT
GGGGGGCAATATGGCATGATGGCTGTGCCACGTATTGGTCATGAAGTGATTGTTAGCTTCTTAGAGGGCG
ATCCCGATCAGCCAATTATTACAGGTAGAGCCTATCACACCACCAATGTAACCCCCTATATCTTGCCTAA
TCATAAAACCCGAACCGTGATTAAAACCCAGAGTCATAAAGCCGAAGGGTTTAATGAACTGCGTTTTGAA
GATGAGGCCAGTCGTGAGCAGATCTATGTTCATGGACAGAAAGATATGGATATGGTGATTAACAATATTC
ATAGAGAGGAGATTGGCTACGATCAGCATCTGACTGTTGAACATGACAAATTTGAACTGGTTAAGCAGCA
CCGCCATACAACAATAGGACAAGATGAGATAGCTCAAGTTGGGCGGGATCATCAAGTCCTTGTTGGACGT
AACCTTATTCACCGAGTGGTAGGTATGGTTAAGCGTTATATTGGCGGGGGCATCATTACTCAAATTGATG
GTGCTAGCCAGACGAGTATTGCAGCCTCGGAAGAGAAGATAATTGGCGCCAATCAACAGATCAAAGTCGA
TAACGAGAGCTATCTTAAAGCAAGTAAAATCGTCCTCGAAGCTGGTGATGAACTCACTATTAAAGGTCCC
GGTGGCTTTATTAAGATTGATAGCGGTGGTGTGACTATCTCTGGCAGTAAAGTGAAGATAAATGAGGGCG
GATCCCCTGGAACAGGGACAGCGCCTAAAGCGGTGAAACCAGAAGAGCCCGCTAAACCTTCAATCCCAGA
AACTGCTGATAGGCGTTAA
 Primer design