SecReT6
Protein ID: 170726861
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2515
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3071256..3072461 [-]
Producthypothetical protein
NoteTssA
UniProt IDB1KGS3
KEGG IDswd:Swoo_2515
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.50E-07, Aligned region: 45..92
ImpA-rel_N [PF06812], Evalue: 1.50E-07, Aligned region: 135..147
ImpA-rel_N [PF06812], Evalue: 1.50E-07, Aligned region: 286..303
Protein Sequence: 401 a.a.     [Download]
>gi|170726861|ref|YP_001760887.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MDNTSRKLDCFNLASELTELRNSAAYQQMRVEINRRNNPLSGGTDWEKVYQLALQISSGLGADLLTSAYF
VTAASKTRGVSGLASGLDLMLSVVSFSTELAQLPSEKVSEIINWAVTKVTPEIKKMAVTSSNVRDWYRCE
HACQKLFELITQKQPQQVPNLDVLGYLIFEKIDLLETNKVSVLPSSASNTVPVKVKARRWPLWALSSLIV
ICSLLSGYLAVLYHQEVSGKLPLWLYQAPEEKVAPESSIAQRIDRAFSLPQGEPLVSIYPEQVSLLVELD
KNYQRFANARTIMANLSQLSQALPESSNKMKQETLSIAQYASSLSPILGRTYYIGDLLEDKEYARAEVEL
NQLNSQLKALLIKRTLLAQQLHNQQSDESGTLQLELSSQPSSDVISQDGER
 
Nucleotide Sequence: 1206 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3072461-3071256 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGGACAACACGAGTCGTAAACTGGACTGCTTTAATCTTGCATCTGAATTAACAGAGCTTAGGAATAGCG
CTGCTTATCAACAAATGAGAGTCGAGATCAATCGACGTAACAACCCACTGAGCGGTGGAACCGACTGGGA
GAAGGTGTATCAACTCGCCCTGCAAATTTCATCGGGATTGGGGGCCGACCTATTAACCTCTGCATACTTC
GTTACGGCTGCATCGAAAACACGAGGGGTGTCAGGTCTTGCCTCAGGCTTAGATTTGATGCTGTCGGTCG
TTTCCTTCTCCACGGAGTTAGCTCAACTCCCCAGTGAAAAAGTATCTGAGATCATCAACTGGGCTGTGAC
TAAGGTGACTCCAGAAATAAAGAAGATGGCGGTCACATCATCGAATGTACGTGACTGGTATCGCTGTGAA
CATGCTTGTCAGAAGTTATTTGAGTTGATCACTCAAAAGCAGCCTCAACAGGTACCTAATCTAGATGTGT
TGGGGTATCTCATTTTCGAAAAGATCGATCTACTTGAAACCAATAAAGTGAGTGTGTTGCCCAGCTCAGC
TTCAAATACAGTACCGGTTAAGGTAAAAGCTAGACGTTGGCCCTTATGGGCTCTGAGTAGCTTAATTGTT
ATTTGTAGTCTGCTAAGCGGTTATCTGGCTGTACTTTACCATCAAGAGGTGAGTGGAAAATTACCGTTAT
GGCTGTATCAAGCACCAGAAGAAAAGGTCGCCCCTGAGTCATCGATTGCGCAGCGTATTGATAGGGCATT
TAGCTTGCCACAGGGCGAGCCTTTAGTTTCTATCTATCCTGAACAAGTGAGCTTACTGGTTGAGTTAGAT
AAAAATTATCAAAGGTTTGCTAACGCAAGAACCATCATGGCTAATTTAAGCCAGCTTTCACAGGCTTTGC
CAGAAAGTAGCAATAAAATGAAGCAAGAAACCCTCTCTATTGCCCAATATGCCAGCAGCTTATCACCTAT
TTTAGGACGAACTTATTACATTGGGGATCTGTTAGAGGACAAGGAGTATGCCAGGGCAGAAGTTGAACTT
AATCAGTTGAATAGCCAGTTAAAGGCTTTGTTGATAAAAAGAACCTTGCTTGCCCAACAGCTCCACAATC
AACAGTCTGATGAGTCTGGTACACTGCAACTAGAGCTAAGTTCTCAGCCTAGCAGTGACGTTATATCTCA
AGATGGGGAGAGATAA
 Primer design

Protein ID: 170726863
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2517
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3076114..3077517 [-]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDB1KGS5
KEGG IDswd:Swoo_2517
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.00E-16, Aligned region: 48..108
Protein Sequence: 467 a.a.     [Download]
>gi|170726863|ref|YP_001760889.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MTHQYIEKIAKPIAGDNPVGERLFDDVLFDFVEGQLMKVGSLSHAEVQWGEVETAVVSLLETRTKDLKLI
IYLMQCLQYQASLERFSLSLGVLDIFMKEYWLTCYPAPGDRGVLPRRKYFSQIVQRTVKSGESIDTQFCE
PQSKELLLKRLSSLLDSAEKLELPTEVLSSLATRLTRQLEQNENRVSATKSNAVSEPAEEAVSRSAPKLE
IDSSNDKATKQTLLKVADFISEFETGTGLSLRIRRFATWSSVSGVPENANAAGETSLMPIAADRVSEYQS
QLEKGADMALLRRVELSLTLSPFWLDGHHLSAQIAMALGQLEWAKAIHEDTAAFVERLPKLLMMSFKGGI
PFANAETRTWLDEGYGRNSFEGNGQGVEQKRAEVVELADSGGLSVAFASLNEHLQQASEPRDAFYLRLLG
ADLKQSHQLSAMATVDYQVLYQQASHMVLADWEPTLMARLKQKANLD
 
Nucleotide Sequence: 1404 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3077517-3076114 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGACACATCAATATATTGAAAAGATAGCGAAACCCATTGCTGGAGATAATCCTGTCGGTGAAAGACTTT
TTGACGATGTTTTGTTTGATTTTGTCGAAGGTCAATTGATGAAGGTTGGATCTCTTTCTCATGCAGAGGT
TCAGTGGGGAGAGGTGGAAACCGCTGTGGTCTCATTATTGGAGACTCGCACTAAAGATCTAAAGCTCATC
ATCTATTTGATGCAATGCCTTCAATACCAAGCCAGCCTTGAGCGATTTAGTTTATCCCTTGGTGTTTTAG
ATATCTTCATGAAGGAGTATTGGCTGACTTGCTACCCTGCACCAGGGGATAGGGGCGTACTACCTAGGCG
CAAATATTTCTCTCAGATTGTTCAGCGAACGGTAAAGTCTGGGGAAAGTATCGATACACAATTTTGTGAG
CCACAAAGTAAAGAGTTGCTGCTTAAGCGCTTGTCCAGCTTACTCGACTCGGCTGAGAAGTTGGAGCTGC
CTACGGAGGTGCTCTCCTCATTAGCAACAAGACTAACCAGACAGTTAGAGCAAAATGAAAACAGAGTATC
GGCAACCAAGTCGAACGCGGTCAGTGAACCTGCTGAGGAGGCGGTAAGCAGAAGTGCGCCTAAGTTAGAG
ATAGACTCGAGCAATGATAAAGCGACCAAACAAACCTTGCTTAAAGTGGCTGATTTTATCTCTGAGTTTG
AAACTGGGACAGGACTAAGCTTGCGGATCCGTCGATTTGCTACTTGGTCATCAGTGAGCGGTGTGCCAGA
AAATGCCAATGCTGCTGGTGAAACCAGTTTGATGCCGATTGCAGCCGATAGGGTCAGTGAGTATCAAAGT
CAGCTAGAGAAAGGGGCGGATATGGCGCTGCTTAGGCGCGTTGAGTTGAGCCTGACGTTAAGCCCTTTTT
GGTTAGATGGACACCACTTAAGTGCCCAAATTGCCATGGCGCTTGGGCAGCTAGAGTGGGCTAAGGCGAT
ACATGAAGACACTGCGGCCTTTGTTGAACGTCTGCCTAAGCTACTCATGATGTCATTTAAAGGCGGCATT
CCTTTTGCCAATGCCGAGACTCGAACTTGGTTAGATGAAGGTTACGGACGCAACAGTTTTGAAGGGAACG
GGCAGGGAGTTGAGCAAAAAAGGGCTGAGGTGGTTGAGCTGGCAGATTCGGGTGGCTTATCGGTCGCTTT
TGCCAGTTTGAATGAACATCTACAGCAAGCATCAGAGCCTAGAGATGCATTTTATCTACGTCTGCTGGGT
GCAGATCTAAAACAGAGTCATCAATTGTCAGCGATGGCAACGGTGGATTATCAAGTCTTGTATCAACAAG
CAAGTCATATGGTCTTAGCTGATTGGGAGCCAACCTTGATGGCTCGATTAAAACAAAAAGCAAATTTGGA
TTAA
 Primer design