SecReT6
Protein ID: 170726862
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2516
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3072533..3076096 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB1KGS4
KEGG IDswd:Swoo_2516
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.80E-88, Aligned region: 510..829
ImcF-related_N [PF14331], Evalue: 1.90E-82, Aligned region: 200..461
DUF1215 [PF06744], Evalue: 2.20E-36, Aligned region: 584..614
DUF1215 [PF06744], Evalue: 2.20E-36, Aligned region: 855..887
DUF1215 [PF06744], Evalue: 2.20E-36, Aligned region: 923..1045
Protein Sequence: 1187 a.a.     [Download]
>gi|170726862|ref|YP_001760888.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MWSKLKSFFIKLLPELKSALPILLVAIFVLINVGIWWAGPWLVIDESKPLSSVNSRLIATVIFSLSCFTI
WGWFQWRKLKQYNVDNEKSQQLKDDPIIGMVERQEVELNDVMLGLKESLNTRNYLYALPWYLVLGVENAG
KTSLINRSGQKFVFSSVMRASGKKTENPYSFDWWISDDAVLIDPDGELLTQRTEEGSNNGEMSKRLWMHF
VEWLDKTRSRRPLNGVVLALDMANMVSAPTSDRKAYAHLMRARLRELMETLSTRLPVYITLTKLDLLLGF
EPFFRHYNQAERDEIMGFTFSLNSVNDLDSWLEEFNEDYTDFISRINAHLPRALLQCRDKEERAAIYSFV
RQVAGAHQVLQEFFADALASDQFSTSALVRGVYFTSVYQQGVPTNAYVDSASRRYGLRESINSAQKSDNS
TPYFIHTLFQKIIYPEAGLASDNFKVAKQKRRLMLLSFVACSIASVLLVGTWHRYYLQNSQQADAVLDKV
TEFNELNDQTSFDQLGKSIIPPLNTIRTATLEFGFFREKPKLISDFGLYQGHTIGPKVEETYLKLLSYRY
LPALLKQVATDMSDAPTNSNEKLAMLRVFRMMVDKSGRHDDFVKAYFTQAWQTSYEGDRVLQTQLMEHLE
YALQHTDLQAMRDDGAVEAENKLRPYDRLIAKTQRELSSLPIEQRVYRQLKQSASSQLGSALDLKVATGP
AYELVFEQRVSDENAPNAMKIPRLLSKQGFERYFIPQSDSIADLALIDSWVLGQSESTDFSDADKISLRN
KIINQYTLDYQSSWRKALNDFELKDFTDINHGVLVIDNFAISNRPVNRILDNLTRNTELFPSMPDDASAM
AEIIETPQYQIAAKIDGDFTDLNQLTKTDGTQPVYLDEVMESVVRLHAYLKSIQDAPDVGKAALKAAQER
LTLNDADPIYALERISTSLPKPMDTMVGKLASESWKVVLQSAIKHLEVRWYNEVYQDYQQNLASRYPFNP
ASTKQVSIDDFQSFFGPEGTLSRFYNDQMKMFLEENFDALNQFSKGDSNLVRREVLQSLKQAQQIQKAFF
NPKGNLDVEFSLEALQMSPNKRRSVMNIDGQYVEYTHGPKRGIDLVWPNTLRDSTVSKLTLVPSESNASP
RSIVFEGPWAFFRLLDSARMSGSSSTSIDYQFEVDKGDVTYRLRTRDNVNPFTSKLLSSFEIPKTLY
 
Nucleotide Sequence: 3564 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3076096-3072533 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGTGGTCTAAGCTCAAATCTTTCTTTATTAAGCTATTACCGGAACTCAAATCGGCTTTGCCTATTTTGT
TAGTTGCCATTTTTGTTTTGATCAATGTGGGGATCTGGTGGGCAGGCCCTTGGCTTGTGATTGATGAAAG
TAAGCCTCTGTCGAGTGTTAACTCAAGACTGATCGCTACTGTTATCTTCTCCTTGTCCTGTTTTACCATT
TGGGGTTGGTTCCAATGGCGAAAGCTAAAGCAATACAATGTCGATAATGAGAAGTCACAGCAGTTAAAAG
ACGATCCCATCATTGGCATGGTAGAGCGTCAGGAGGTTGAACTTAATGATGTGATGTTGGGGCTTAAGGA
GAGCCTTAACACACGAAACTATCTCTATGCGCTTCCTTGGTATCTAGTACTAGGGGTAGAAAATGCGGGT
AAAACCAGTTTGATTAACCGTTCTGGTCAAAAGTTTGTCTTCTCCTCTGTGATGAGGGCATCGGGTAAGA
AAACCGAGAATCCTTACTCATTTGATTGGTGGATCAGTGATGATGCGGTATTGATCGATCCCGATGGAGA
GCTATTGACCCAAAGAACGGAAGAGGGAAGCAACAACGGTGAGATGAGCAAGCGGCTTTGGATGCATTTT
GTCGAGTGGCTAGATAAAACACGTAGCCGTCGTCCATTAAATGGGGTTGTTCTGGCACTAGATATGGCAA
ATATGGTGAGTGCGCCGACATCTGATCGTAAAGCTTATGCCCACCTAATGCGTGCGCGTTTACGTGAGTT
GATGGAAACCCTATCGACTCGTCTTCCTGTCTATATCACCTTGACTAAGCTTGATCTTTTGTTGGGATTT
GAACCATTTTTCCGTCACTACAATCAGGCTGAGCGTGATGAGATCATGGGATTCACCTTTTCACTAAACT
CAGTCAATGATCTTGATAGTTGGCTTGAAGAGTTCAATGAAGATTATACCGACTTTATCAGCCGTATTAA
TGCCCATCTTCCACGCGCGCTACTTCAATGTCGTGATAAAGAGGAGCGGGCAGCCATCTACAGTTTTGTT
AGGCAAGTCGCTGGTGCTCATCAAGTTCTTCAGGAGTTTTTTGCAGATGCACTGGCAAGCGATCAGTTCT
CGACCTCTGCACTGGTGCGAGGCGTCTATTTTACCTCTGTGTATCAGCAAGGGGTGCCGACTAATGCTTA
TGTCGATAGTGCTTCTCGTCGCTATGGACTTAGAGAATCGATAAATAGTGCACAAAAAAGCGATAATTCA
ACGCCATATTTTATTCATACTCTGTTTCAGAAGATCATCTACCCTGAGGCAGGTTTAGCCTCTGATAATT
TTAAAGTCGCAAAGCAGAAAAGGCGGCTTATGTTGCTCTCCTTTGTTGCTTGCTCTATCGCTTCTGTACT
GCTGGTGGGCACTTGGCATCGCTACTACTTACAAAACAGCCAGCAAGCCGATGCTGTACTGGATAAGGTG
ACTGAGTTTAATGAGCTCAACGATCAAACAAGCTTTGATCAACTCGGTAAGAGTATTATTCCGCCGTTAA
ATACCATACGTACGGCTACGTTAGAGTTTGGTTTTTTCCGTGAAAAACCTAAGTTAATCTCTGACTTTGG
GCTGTATCAGGGCCATACCATAGGTCCAAAAGTTGAAGAGACCTATTTAAAGCTGCTCTCTTACCGTTAT
TTGCCTGCACTGCTAAAGCAGGTGGCAACAGATATGTCTGATGCACCGACCAATAGCAATGAGAAGCTGG
CTATGCTCAGAGTGTTTCGAATGATGGTGGACAAAAGCGGACGTCATGATGATTTTGTGAAAGCCTATTT
CACCCAAGCATGGCAAACATCCTATGAAGGTGACAGGGTTTTGCAAACTCAGTTGATGGAGCACCTTGAG
TACGCACTGCAACATACCGACCTTCAAGCGATGCGAGACGATGGGGCTGTGGAAGCGGAAAATAAGTTAC
GACCCTATGACCGCTTGATAGCAAAAACTCAAAGAGAATTAAGCAGTCTACCCATAGAGCAGCGGGTTTA
TCGCCAGCTTAAGCAATCAGCCTCTTCACAACTGGGTAGTGCACTCGACCTTAAGGTTGCAACAGGTCCC
GCTTACGAGTTGGTGTTTGAGCAAAGAGTGAGTGATGAAAATGCGCCAAATGCGATGAAGATCCCTCGTT
TATTGAGTAAACAAGGTTTCGAGCGTTACTTTATCCCGCAGTCTGATTCCATTGCCGATCTGGCCTTGAT
TGATAGCTGGGTACTTGGTCAATCTGAGTCAACGGATTTTAGTGATGCAGATAAGATAAGTTTGCGTAAT
AAGATCATTAACCAATACACGTTAGATTATCAGTCATCTTGGCGAAAGGCGCTAAACGACTTTGAATTAA
AGGATTTTACAGACATTAATCACGGGGTATTAGTGATTGATAATTTTGCCATTAGCAATCGTCCTGTGAA
TCGCATTTTAGACAATTTGACCAGAAATACTGAGCTATTCCCATCGATGCCAGATGATGCCAGTGCTATG
GCGGAGATTATTGAGACGCCTCAATATCAGATAGCGGCCAAGATTGATGGTGATTTTACAGATTTAAACC
AACTGACTAAGACTGATGGAACTCAACCTGTCTATTTGGATGAGGTGATGGAGTCTGTCGTGCGTTTACA
TGCTTATCTTAAGTCTATTCAAGATGCCCCCGATGTTGGTAAAGCGGCGCTTAAAGCGGCTCAGGAGCGT
CTGACACTTAATGATGCCGATCCTATTTATGCGCTGGAAAGGATCTCAACCAGTTTGCCAAAACCTATGG
ATACCATGGTTGGCAAACTAGCAAGTGAAAGCTGGAAAGTGGTACTACAAAGTGCCATTAAGCACTTAGA
GGTGCGTTGGTATAACGAGGTGTATCAGGATTATCAACAAAACCTAGCTTCGCGTTATCCGTTTAATCCC
GCATCGACAAAGCAGGTATCTATCGATGACTTTCAAAGCTTTTTTGGTCCCGAAGGCACGTTAAGTCGTT
TTTATAACGATCAGATGAAGATGTTTCTTGAAGAGAACTTTGATGCACTAAACCAATTTAGTAAAGGAGA
TTCCAATCTAGTACGCCGCGAGGTACTTCAATCGCTTAAGCAGGCACAACAGATCCAGAAAGCCTTCTTT
AATCCGAAAGGAAACTTGGATGTGGAGTTCTCGTTAGAGGCGCTGCAGATGAGTCCAAATAAACGTCGAA
GTGTGATGAATATTGATGGTCAGTATGTGGAGTACACTCATGGCCCTAAACGAGGTATCGATCTGGTGTG
GCCAAATACGTTACGTGACTCTACAGTCAGTAAATTAACCTTGGTGCCAAGTGAGTCAAATGCGTCACCA
CGCTCGATTGTGTTCGAAGGGCCTTGGGCATTTTTCCGCTTATTAGATAGTGCAAGAATGTCCGGTAGTA
GTTCAACCAGTATCGATTACCAGTTCGAAGTCGATAAAGGTGATGTCACCTACCGCCTACGTACGCGAGA
TAATGTGAATCCATTTACCAGCAAACTACTGAGTAGTTTTGAGATCCCAAAAACCTTGTATTAA
 Primer design