SecReT6
Protein ID: 170726866
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2520
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3079716..3082307 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1KGS8
KEGG IDswd:Swoo_2520
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.60E-39, Aligned region: 601..762
AAA [PF00004], Evalue: 1.90E-18, Aligned region: 18..51
AAA [PF00004], Evalue: 1.90E-18, Aligned region: 220..350
AAA [PF00004], Evalue: 1.90E-18, Aligned region: 607..725
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 279..350
AAA_5 [PF07728], Evalue: 2.50E-12, Aligned region: 606..724
ClpB_D2-small [PF10431], Evalue: 9.50E-12, Aligned region: 431..470
ClpB_D2-small [PF10431], Evalue: 9.50E-12, Aligned region: 768..842
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 113..113
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 197..237
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 264..298
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 467..523
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 582..645
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 677..699
AAA_16 [PF13191], Evalue: 1.00E-10, Aligned region: 764..790
AAA_22 [PF13401], Evalue: 4.30E-08, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 4.30E-08, Aligned region: 603..629
AAA_25 [PF13481], Evalue: 2.40E-05, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 2.40E-05, Aligned region: 601..639
AAA_19 [PF13245], Evalue: 3.70E-05, Aligned region: 217..242
AAA_19 [PF13245], Evalue: 3.70E-05, Aligned region: 601..628
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 220..270
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 607..641
NACHT [PF05729], Evalue: 0.00033, Aligned region: 220..247
NACHT [PF05729], Evalue: 0.00033, Aligned region: 441..489
NACHT [PF05729], Evalue: 0.00033, Aligned region: 607..635
AAA_29 [PF13555], Evalue: 0.00044, Aligned region: 213..238
AAA_29 [PF13555], Evalue: 0.00044, Aligned region: 602..617
Sigma54_activat [PF00158], Evalue: 0.00056, Aligned region: 218..234
Sigma54_activat [PF00158], Evalue: 0.00056, Aligned region: 587..704
DUF258 [PF03193], Evalue: 0.00077, Aligned region: 214..237
DUF258 [PF03193], Evalue: 0.00077, Aligned region: 605..647
AAA_14 [PF13173], Evalue: 0.0018, Aligned region: 221..300
AAA_14 [PF13173], Evalue: 0.0018, Aligned region: 605..694
Arch_ATPase [PF01637], Evalue: 0.002, Aligned region: 200..233
Arch_ATPase [PF01637], Evalue: 0.002, Aligned region: 272..304
Arch_ATPase [PF01637], Evalue: 0.002, Aligned region: 606..646
Arch_ATPase [PF01637], Evalue: 0.002, Aligned region: 677..688
Clp_N [PF02861], Evalue: 0.0023, Aligned region: 24..72
Clp_N [PF02861], Evalue: 0.0023, Aligned region: 307..317
DUF815 [PF05673], Evalue: 0.0036, Aligned region: 216..259
DUF815 [PF05673], Evalue: 0.0036, Aligned region: 557..639
IstB_IS21 [PF01695], Evalue: 0.0042, Aligned region: 214..242
IstB_IS21 [PF01695], Evalue: 0.0042, Aligned region: 605..624
IstB_IS21 [PF01695], Evalue: 0.0042, Aligned region: 779..808
TIP49 [PF06068], Evalue: 0.0099, Aligned region: 221..256
TIP49 [PF06068], Evalue: 0.0099, Aligned region: 268..300
TIP49 [PF06068], Evalue: 0.0099, Aligned region: 605..641
Protein Sequence: 863 a.a.     [Download]
>gi|170726866|ref|YP_001760892.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MIRIELSTLITKLNPISKLAMEEAASLCIARQNEEITLSHLLYSLLENPLSDVRVLLKHAECDISELKTL
LGNSLPTGDTLDTYPSFSPLLVELLQDAWLLSTTELQEAELRSGSLFLAALMQSSRYLPFELVNFFADIN
RESWRKNFARLTASSSESKAREASTGRQPVQDSANSALDKFTTNFTQFAEDGELDPVLCRDDEINLMIDI
LCRRRKNNPIVVGDAGVGKSAVVEGLALRIVAGNVPDSLKGVQLLSLDLGLLQAGASVKGEFEKRLKGVI
DEVKNSAIPIILFIDEAHTLIGAGNQEGGGDAANLLKPALARGELRTIGATTWKEYKKYFEKDPALTRRF
QLVKLDEPSAEQAVVILRGLHGVYESEHKVLIQDCALKAAAHLSSRYLSGRQLPDKAIDVLDTACARIAI
NLTSPPRYLAELQGIIHQTEVEISLLLRQRTIGQSIDEEHLELLRERVTDAMSEHESLESTWRQQQELVS
KIIELRGAILAGDADDVPQELCIELNDVEEQLELLSAKNRLVIPQVDEQQIAAVIADWTGVPVEQMNSDE
LHKITHLPQLLGESLKGQDIAISRLHQNMLTARADLRKAGRPKGAFLLVGPSGVGKTETVIQIAEQLYGG
KQFLTTINMSEYQEKHTVSRLIGSPPGYVGFGEGGVLTESIRKMPYSIVLLDEVEKAHPDVLNLFYQAFD
KGELADGEGRLIDCQNILFFLTSNLGYQTIVDNAQTPELIENSLYPELSAFFKPALLARMEVVPYLPLGE
NVLREIIAAKLAALTQRLELRYKAQVSCDQALTDEIIRRTTRTENGARMLEAIIDGQMLPPIALALLNKL
ADKEPVQTIRLSCVDGEFVGEVS
 
Nucleotide Sequence: 2592 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3082307-3079716 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGATCCGTATTGAATTAAGTACGCTTATTACTAAGTTAAATCCAATCAGCAAGCTTGCTATGGAAGAGG
CGGCTTCTTTGTGTATCGCGAGGCAGAATGAGGAGATAACCCTATCTCATCTGCTGTATAGCTTGTTAGA
AAATCCACTGTCCGATGTGAGAGTACTACTTAAGCACGCTGAGTGTGACATTAGTGAGCTAAAAACACTT
TTAGGTAATAGTTTACCAACTGGGGATACCTTAGATACCTACCCATCATTTTCTCCACTTTTAGTTGAGT
TACTGCAAGATGCTTGGTTGCTGTCCACCACTGAATTACAAGAGGCTGAGCTGAGATCCGGTAGCCTTTT
CCTCGCCGCATTAATGCAATCGAGCCGTTACCTCCCTTTTGAGCTTGTTAATTTCTTCGCTGATATTAAC
CGAGAATCATGGCGTAAAAATTTCGCAAGATTAACAGCTAGCTCTTCAGAATCGAAAGCGCGCGAAGCCT
CTACTGGCCGTCAGCCTGTGCAAGATAGTGCCAACAGTGCATTAGATAAATTCACCACTAACTTTACTCA
ATTTGCAGAGGATGGCGAGTTAGACCCAGTGCTGTGCCGTGACGATGAGATCAACCTGATGATTGATATT
CTATGTCGCCGCCGTAAAAACAACCCTATCGTTGTCGGTGATGCCGGTGTGGGTAAAAGCGCTGTGGTAG
AGGGACTGGCTTTGCGTATTGTTGCTGGTAATGTGCCTGATTCCTTAAAAGGAGTGCAACTGCTGTCGCT
GGATTTAGGCTTACTTCAAGCTGGAGCTTCGGTGAAAGGGGAGTTTGAAAAGCGTTTAAAAGGGGTGATT
GATGAAGTTAAAAACTCAGCCATTCCCATTATTCTTTTTATCGATGAAGCACACACCTTAATCGGCGCTG
GCAATCAAGAGGGGGGAGGCGATGCCGCCAACTTGCTAAAACCTGCCTTAGCACGGGGTGAGTTACGTAC
AATTGGTGCAACGACGTGGAAAGAGTACAAGAAATATTTTGAAAAAGATCCCGCGCTCACTCGCCGTTTT
CAGTTGGTAAAATTGGATGAACCTAGCGCCGAACAAGCGGTTGTGATACTGCGTGGTCTACATGGTGTGT
ACGAGTCTGAACATAAAGTGTTGATCCAAGATTGCGCGCTGAAAGCTGCGGCGCATCTATCAAGTCGTTA
CCTTTCTGGGCGACAACTGCCAGATAAAGCCATCGATGTGCTCGATACTGCATGTGCGCGCATTGCCATT
AATCTTACCTCTCCACCTCGATATCTTGCAGAGCTGCAAGGCATTATTCATCAGACAGAAGTGGAGATCT
CACTGTTATTGAGACAGAGAACCATAGGCCAGAGTATTGATGAGGAGCATCTTGAGCTATTAAGAGAACG
AGTGACGGATGCAATGTCAGAGCATGAATCATTAGAGTCGACTTGGAGGCAGCAGCAGGAGCTAGTCTCT
AAAATCATCGAGCTGAGAGGCGCGATATTAGCAGGTGACGCTGATGATGTGCCCCAAGAGTTGTGTATTG
AACTCAATGACGTTGAGGAGCAACTTGAGTTACTTAGTGCCAAGAATCGTTTAGTTATTCCCCAGGTGGA
TGAACAGCAAATTGCGGCTGTGATTGCTGATTGGACCGGTGTGCCAGTTGAGCAGATGAACAGCGATGAG
CTGCATAAAATCACCCATCTGCCTCAGCTGCTTGGAGAGTCATTAAAAGGACAAGATATCGCCATCTCTC
GTCTGCATCAAAATATGCTGACAGCAAGAGCCGATCTGCGTAAAGCTGGTCGTCCCAAAGGTGCATTTTT
GCTCGTTGGTCCAAGTGGTGTGGGTAAAACCGAGACCGTGATTCAAATTGCTGAGCAGCTCTATGGCGGT
AAGCAGTTTCTAACGACAATCAATATGTCCGAATACCAAGAGAAGCACACGGTATCTCGATTAATTGGCT
CACCTCCAGGATACGTTGGCTTTGGTGAAGGAGGTGTATTAACTGAATCCATTCGTAAAATGCCTTACTC
CATTGTACTGCTCGATGAAGTTGAGAAGGCGCACCCCGATGTGTTGAACCTTTTCTATCAAGCATTCGAT
AAAGGGGAGCTTGCCGATGGTGAGGGGCGTCTTATCGATTGTCAGAATATTCTCTTCTTTTTGACCTCCA
ACTTAGGCTATCAAACCATCGTTGATAATGCACAAACGCCAGAGCTGATTGAGAACAGTCTCTATCCTGA
GCTTTCGGCATTTTTTAAACCTGCTCTGCTTGCTCGTATGGAGGTTGTGCCCTATCTACCACTTGGTGAA
AACGTGCTGCGTGAAATTATTGCTGCCAAGTTAGCCGCGCTGACCCAACGACTTGAGCTTAGATATAAAG
CACAGGTGAGCTGCGATCAAGCACTTACCGATGAGATCATCAGACGGACAACCCGTACTGAAAATGGTGC
GCGTATGTTAGAGGCGATCATCGATGGTCAGATGTTACCTCCTATTGCATTGGCTCTGCTTAATAAATTA
GCAGATAAAGAGCCTGTGCAAACCATTCGATTAAGTTGTGTTGATGGTGAGTTTGTCGGAGAGGTGAGTT
AG
 Primer design