SecReT6
Protein ID: 170726867
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2521
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3082317..3083102 [-]
Producthypothetical protein
NoteTssL
UniProt IDB1KGS9
KEGG IDswd:Swoo_2521
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 2.00E-71, Aligned region: 40..245
Protein Sequence: 261 a.a.     [Download]
>gi|170726867|ref|YP_001760893.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MKPQKQPLTEQQLDDVLFDEVRNIDADKEYWFQLRGDNINQLIDAATPLMGMVFRVRKLAVLDDVQKLYH
NTVDDIMAIEAELTESGFGRAIILAYRYVLCSFIDEAVMNTPWGADSVWAEHSLLTRFHNETWGGEKVFS
ILQRLETEPASYRELLEFIYLCLCLGFEGRYKVVVNGREEFDKIVNRLYETLRHLRDEEPELLSNATDHV
VNTKFQIGRQMPIWTIFAGFFVMLAVIFIFYSVSLANKSAGVLDQLFQILN
 
Nucleotide Sequence: 786 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3083102-3082317 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGAAACCACAAAAACAGCCTCTGACAGAGCAACAACTCGATGATGTTTTGTTTGATGAAGTGAGAAACA
TAGACGCCGACAAAGAGTATTGGTTTCAATTACGTGGCGACAATATTAATCAACTTATTGATGCTGCAAC
CCCACTTATGGGGATGGTCTTTAGAGTGCGAAAGTTAGCTGTGTTAGATGATGTGCAAAAGCTCTATCAC
AATACGGTTGACGACATTATGGCCATCGAAGCTGAACTGACTGAGTCAGGCTTTGGTCGGGCGATTATCT
TAGCGTATCGCTACGTGCTCTGCTCATTTATCGATGAAGCGGTGATGAATACTCCTTGGGGAGCCGACAG
TGTCTGGGCTGAGCATTCACTGCTGACCCGTTTTCATAATGAAACCTGGGGCGGTGAGAAAGTGTTTAGC
ATTCTCCAGCGGCTAGAGACTGAACCTGCAAGCTACCGCGAGCTGCTCGAGTTTATCTATCTTTGCCTCT
GCTTAGGATTTGAAGGGCGCTATAAGGTGGTGGTTAACGGCCGTGAAGAGTTCGACAAAATCGTGAATCG
TCTCTATGAAACCTTAAGGCACCTTAGGGATGAAGAGCCGGAGCTGCTATCCAATGCAACTGATCATGTG
GTTAATACCAAGTTTCAAATTGGCAGGCAGATGCCCATCTGGACCATATTTGCTGGTTTTTTTGTGATGC
TAGCGGTGATCTTTATCTTCTACTCGGTGTCGCTAGCCAATAAATCAGCAGGTGTGTTGGACCAACTGTT
TCAGATCTTAAATTAA
 Primer design