SecReT6
Protein ID: 170726868
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2522
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3083105..3084439 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB1KGT0
KEGG IDswd:Swoo_2522
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-159, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|170726868|ref|YP_001760894.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MSSRNRVIWAEGLFIKPQHFQQQQRYFEYVTDERMTSVNSYLYGISQLELNPEYLGFGRIAIQRAKGVMP
DGTVFNIPQEDVLPSALEVVDGSLANQIVYLALSLRSDSITEVTESTSSGNTRFVTHRHEVRDIHSEQGD
FSTIDVSPVQMKLMFEKEDRSAYSSVAIAKILEKRPDGSVVLDPNFIPCHYNVLGVPFLHRFIGEMAGMM
RERAKNIAVRIGSPSQGGVADVSDFMLLQALNRMQPVLQHLSQLKSLHPEQLYQTLVSICGELFSFTDDS
RIAPIFKPYDHDMPITSFGQLMNMLRQSLSIVLEPKAVSLQLQKRKYGLMVAPVQDPDLIKEADFILAVR
AKLPLEELKKLFIQQTKIASVEKIRELISLQLPGVGLTPLPVAPRQLPYHAGYTYFQLDRTSPSWEMLQH
STGFAFHVAGEFPELELQFWAIRS
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3084439-3083105 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGTCGTCAAGAAATAGAGTAATTTGGGCTGAAGGTTTATTCATCAAGCCACAACATTTTCAGCAGCAGC
AACGTTATTTTGAGTATGTCACCGATGAGCGTATGACCTCGGTCAACAGCTACCTCTACGGTATATCACA
GCTCGAGCTAAACCCTGAGTACCTCGGGTTTGGTCGTATTGCGATTCAACGAGCTAAAGGCGTGATGCCA
GATGGAACAGTATTTAATATTCCCCAAGAGGACGTTCTGCCTAGTGCACTGGAAGTTGTTGATGGCTCAT
TGGCCAACCAGATAGTGTATCTGGCACTGTCACTACGCAGTGATTCGATAACTGAAGTGACGGAGAGTAC
CTCATCGGGTAATACCCGCTTTGTGACTCATCGCCATGAGGTGCGAGACATTCATAGTGAGCAGGGGGAT
TTTTCTACCATAGATGTCAGCCCTGTACAGATGAAGCTGATGTTTGAAAAAGAGGATCGCAGTGCCTACT
CCTCAGTGGCGATAGCTAAAATCTTAGAAAAACGTCCAGATGGTAGTGTGGTTCTGGATCCTAACTTTAT
TCCTTGTCATTACAATGTGCTGGGTGTGCCGTTTCTGCATCGATTCATTGGTGAGATGGCAGGGATGATG
AGAGAAAGAGCTAAAAATATAGCGGTTAGAATAGGCTCGCCAAGTCAAGGTGGCGTCGCTGATGTGTCAG
ATTTTATGCTGTTACAAGCATTAAATCGCATGCAACCTGTACTGCAACACCTCTCACAACTGAAAAGCCT
GCATCCAGAGCAACTGTATCAGACATTGGTGAGCATTTGTGGAGAGCTATTCTCCTTTACCGATGACAGT
CGAATTGCGCCAATATTTAAACCTTACGATCATGATATGCCGATCACCTCCTTTGGCCAATTGATGAATA
TGCTACGTCAGTCATTAAGTATCGTCCTTGAGCCTAAAGCCGTGTCCTTACAGTTACAGAAACGTAAGTA
CGGATTGATGGTTGCGCCAGTACAAGATCCTGATTTGATCAAAGAGGCTGATTTCATCTTAGCTGTTCGC
GCTAAGTTGCCTTTAGAGGAGCTGAAAAAGCTCTTTATTCAACAAACTAAGATCGCTTCCGTTGAGAAGA
TCCGCGAGTTGATCTCGTTGCAACTTCCTGGTGTCGGTTTAACTCCGCTACCCGTGGCGCCAAGACAGTT
GCCATATCACGCAGGTTACACCTATTTCCAACTTGATAGGACAAGCCCATCTTGGGAGATGTTACAACAC
TCAACTGGATTTGCCTTCCATGTTGCTGGTGAGTTTCCTGAGCTCGAGTTGCAGTTCTGGGCGATAAGGA
GCTAG
 Primer design