SecReT6
Protein ID: 170726869
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2523
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3084442..3084972 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB1KGT1
KEGG IDswd:Swoo_2523
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.50E-37, Aligned region: 16..170
Protein Sequence: 176 a.a.     [Download]
>gi|170726869|ref|YP_001760895.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MKTLRLAFLILLMGQLTACGSVWEGTKKVGAVIWDPSIPVGEPKDLPTQLTYSIVAQQDVNQNPNGDSTP
IEFQLFELEDDSKLLAADYDSLTADFEDALGSNYIDHSDFTMLPGQFKFIEPFEVDEDTRYIGVMAHFGD
PEVSQWKKVIKIKSIGREYHILILFKEQEVILDKVE
 
Nucleotide Sequence: 531 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3084972-3084442 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGAAAACCCTGCGTCTTGCATTTCTCATTCTCTTGATGGGACAGCTGACTGCGTGTGGTTCTGTGTGGG
AGGGGACGAAAAAGGTTGGGGCGGTGATCTGGGACCCCTCAATTCCTGTTGGAGAACCTAAAGATCTACC
GACACAACTCACTTACAGCATAGTGGCTCAACAGGATGTGAACCAAAACCCTAATGGGGATTCAACCCCT
ATCGAGTTTCAACTTTTTGAGTTAGAAGATGACTCTAAGTTGCTCGCCGCGGATTATGACTCGCTAACGG
CTGACTTTGAGGATGCACTGGGGTCAAATTATATCGACCACAGTGATTTCACTATGTTGCCGGGACAGTT
CAAGTTTATCGAGCCGTTCGAGGTCGATGAGGACACACGCTATATAGGGGTCATGGCTCATTTTGGTGAT
CCAGAAGTTTCACAATGGAAAAAGGTAATAAAGATCAAATCGATTGGTAGGGAGTACCACATTTTGATCT
TATTTAAAGAACAGGAAGTCATTCTGGATAAAGTGGAATAA
 Primer design