SecReT6
Protein ID: 170726870
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2524
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3084972..3086246 [-]
ProductFHA domain-containing protein
NoteFha
UniProt IDB1KGT2
KEGG IDswd:Swoo_2524
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 8.90E-06, Aligned region: 14..79
Protein Sequence: 424 a.a.     [Download]
>gi|170726870|ref|YP_001760896.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MPFVNFTQQGGVLGCDINADWRLKDRSGGVKPQHCRIMWVDDQFCLEDLCGEVFVNNSSLPIGLGRFASL
NENDEIKIGPYKVRISLGLSSDPTASMTKRFSEMFSENDLPGLMKEPVSQVAEHSDDTSIDDPMLALDAL
QNRSGENILSFDSRKEKKLDDIDLIDTDISISDREITMQADSEYTQDSAIALKKHTELDGFTMDENTLDL
LESELHAGLDKQGEQLGEHITTGPLFRGLGVQIGSSQNSEQMQDLSVDLGAALKSAITGLLSLHHTANHS
RYELMNKNLQPIEDNPLRLGLGYEDTVKTLFAHDRSPVHLSSAAAIAESLKSIEHHNEAVQSAITEALDY
ILGAFSPAKLLKRFAQYRKSSDLNLDTGDKWAWSMYEQYYEELTSNRQKGFEKLFWEVFEQAYDRKLREL
QKDF
 
Nucleotide Sequence: 1275 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3086246-3084972 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGCCTTTTGTTAATTTCACTCAGCAAGGCGGGGTCTTAGGCTGCGATATTAATGCAGATTGGCGTTTGA
AGGACAGAAGTGGAGGAGTGAAACCTCAACACTGCCGGATCATGTGGGTTGACGATCAGTTCTGCCTAGA
AGATCTCTGTGGTGAGGTGTTCGTTAATAACTCCTCTTTGCCTATCGGTCTGGGTCGATTTGCCAGTTTA
AATGAGAATGATGAGATAAAAATTGGACCCTATAAAGTTAGGATCTCATTGGGGTTAAGCTCAGATCCTA
CCGCAAGTATGACTAAGCGTTTTTCTGAGATGTTCAGTGAAAATGACCTGCCGGGCCTAATGAAAGAGCC
TGTTTCACAGGTAGCTGAACATAGTGATGACACTTCTATTGACGATCCTATGTTGGCGCTAGATGCATTA
CAGAATCGCAGCGGGGAAAACATATTGAGTTTTGACTCCAGGAAAGAGAAGAAACTTGATGATATTGACT
TAATCGATACAGACATATCGATAAGTGACAGAGAGATAACCATGCAAGCTGATTCGGAATATACACAAGA
TTCCGCGATTGCATTGAAGAAACATACTGAATTGGATGGATTTACCATGGACGAAAATACCTTAGACTTG
TTGGAATCTGAACTACACGCAGGGCTTGATAAACAAGGCGAGCAATTAGGGGAACATATTACCACTGGCC
CGTTATTTAGAGGTTTGGGGGTGCAAATTGGCTCATCGCAAAATAGTGAACAGATGCAAGATCTATCAGT
GGATCTTGGCGCCGCGCTAAAATCTGCCATTACAGGGCTACTCTCATTGCACCACACAGCAAATCATAGC
CGCTATGAGTTAATGAATAAGAATCTTCAACCTATTGAAGATAACCCACTGAGATTAGGGCTAGGTTATG
AGGACACGGTGAAAACGCTGTTTGCTCATGATAGAAGTCCAGTTCATCTCTCATCGGCCGCCGCCATTGC
GGAGAGCCTTAAGTCTATTGAACATCATAATGAGGCTGTTCAGTCGGCTATCACAGAAGCGTTAGATTAC
ATCTTAGGGGCATTTTCTCCCGCTAAATTATTAAAGCGTTTTGCGCAATATCGTAAGTCCAGCGATCTTA
ATCTAGATACAGGCGATAAATGGGCTTGGTCTATGTACGAGCAGTATTACGAAGAGTTGACATCTAATCG
TCAGAAAGGGTTTGAAAAACTGTTTTGGGAGGTGTTTGAGCAAGCCTACGACCGTAAATTACGTGAACTT
CAAAAGGATTTTTGA
 Primer design