SecReT6
Protein ID: 170726871
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2525
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3086315..3087322 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB1KGT3
KEGG IDswd:Swoo_2525
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-94, Aligned region: 23..321
Protein Sequence: 335 a.a.     [Download]
>gi|170726871|ref|YP_001760897.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MGYSDRSTATDLIDGGDELIIPDEISSYNFFQLVELIHKLDGNNPEGQEWESLGNMFFSANPSLGFPASD
VTRIERHPKERVQIETTFLGLNGAQSPLPSYMLEELLHDDSNIKRDFLDFFNNRLIALFYRAWRKYRYYI
RFQDNAVDNFSSQVFALVGLANEDVRGETPINWCKMLAYAGMLAGRSRSPQAVAGIVAHCFDLENVSIRE
WEFRHVEIPEPQRCQLGKFNSQLGVDTVLGEKVGDITGKFVLCIKDLSLHRFQDFLPSGKEFMPLCKVME
VILREQMAFDFELTLKTDEVPLLRLGEEKGGQLGWSSFLGQAEIEKQHVLIQIRQ
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3087322-3086315 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGGGATATTCAGATAGGTCAACAGCCACTGATTTAATCGATGGCGGTGATGAGCTAATTATTCCTGATG
AGATTAGCTCCTATAATTTTTTTCAATTAGTTGAATTGATTCATAAATTAGATGGCAATAATCCTGAGGG
ACAGGAGTGGGAAAGCCTAGGGAATATGTTTTTCTCTGCTAATCCCAGTTTAGGTTTTCCAGCAAGTGAT
GTAACAAGAATTGAGCGTCATCCAAAGGAGAGGGTGCAGATTGAAACGACTTTTCTTGGCTTAAATGGTG
CGCAATCACCACTGCCCAGCTACATGCTGGAGGAGTTGCTTCATGACGATAGCAATATAAAACGAGATTT
TTTAGATTTTTTTAATAACAGATTAATCGCCCTGTTTTACAGAGCTTGGCGTAAATATCGTTATTACATA
CGTTTTCAAGATAACGCCGTCGATAACTTCTCATCACAAGTGTTTGCGCTTGTGGGCTTGGCAAATGAAG
ACGTACGAGGTGAGACACCAATTAACTGGTGCAAGATGTTGGCCTATGCAGGCATGTTGGCTGGCAGAAG
TCGTTCACCACAGGCTGTAGCTGGTATCGTTGCTCACTGTTTCGATCTGGAAAATGTATCAATTAGAGAG
TGGGAGTTTAGGCATGTTGAGATCCCTGAGCCTCAAAGGTGCCAATTAGGAAAATTTAACTCTCAGTTGG
GAGTCGATACGGTATTAGGCGAAAAGGTCGGTGATATCACTGGGAAATTTGTGCTCTGTATTAAAGATTT
ATCGCTTCACCGATTTCAGGATTTTCTTCCTTCAGGAAAGGAGTTTATGCCCCTGTGTAAAGTGATGGAA
GTGATCCTTCGAGAGCAGATGGCGTTTGATTTTGAATTGACGCTAAAAACGGATGAGGTTCCCTTGCTTA
GGTTAGGGGAGGAGAAAGGCGGTCAGTTAGGTTGGTCTTCCTTTTTGGGGCAAGCTGAGATTGAAAAGCA
GCATGTGTTAATACAAATAAGGCAGTAA
 Primer design