SecReT6
Protein ID: 170726872
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2526
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3087286..3089052 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDB1KGT4
KEGG IDswd:Swoo_2526
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 7.60E-200, Aligned region: 5..588
Protein Sequence: 588 a.a.     [Download]
>gi|170726872|ref|YP_001760898.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MSQDKYFRDELSFLREQGKQFSDLHPQLARYLHGNNTDPDVERLLEGFAFLTGRLREKIDDEFPELTHSM
INMLWPNYLRPVPSTSIVRFSPIERGISHKQTIEKGCMLDATPVDGEVCHFTTCREVNVYPLVVDHIGSF
HSREASIVDIHLNNLSDLSLNDIGLDDLRFYLGGQDYSAQMLYLWLNHYLEGIEIHVGERHYSLPKSSFK
CVGFASGDGILPYPQNVYEGYRILQEYLSFSDAFMFFDICNIYKCLPSDLTGNFSIKLMFSRTLPADVLI
KDESFQLYCVPVLNLFSHDADPIDLTGKKIEYPIAPSSRKPSHFEIFSVDKVQGWVDSDAGRFRGEERVY
TPFESFQHEIERARERVALYYRLRVKESIREDGFDHFISFVRGDETQSFDVSEAVSISLTCTNRQLPTKL
GKGDICVATDSSPNFATFKNITEPNASLRPVLDGSMLWTLISNLSLNYLSLLSKDALCSIIRAYDFKSLI
DRQAERITQKRLDGIVSIESKPTERILRGMPVRGLMSEIVLDQKYFGSEGDLYLFATVLSRFFALYASIN
SFHQLVVINAANQERYTWDIQIGQQPLI
 
Nucleotide Sequence: 1767 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3089052-3087286 Shewanella woodyi ATCC 51908 chromosome, complete genome
GTGTCTCAAGACAAATATTTCAGGGATGAATTGTCTTTCCTCAGAGAGCAGGGGAAGCAGTTCTCAGATC
TTCATCCACAATTGGCTCGCTACCTACATGGCAACAATACCGATCCAGATGTGGAGCGTTTGTTAGAGGG
GTTTGCTTTTCTAACCGGTAGATTACGTGAAAAAATTGACGATGAGTTCCCTGAGTTAACTCACTCAATG
ATCAATATGTTGTGGCCTAACTATCTTAGGCCAGTACCTAGTACCAGTATTGTGCGCTTCTCTCCTATAG
AACGTGGTATTAGTCATAAGCAGACAATTGAGAAGGGCTGCATGTTAGATGCAACCCCTGTCGATGGTGA
AGTGTGTCATTTCACAACCTGCAGAGAGGTTAATGTCTATCCCTTAGTGGTGGATCACATCGGCTCATTT
CACTCTAGAGAAGCCTCTATTGTTGATATTCACCTGAACAACTTAAGCGATCTTTCACTCAATGATATTG
GGCTTGATGATCTAAGGTTTTACTTAGGTGGACAAGATTACAGTGCGCAGATGCTTTACCTCTGGCTCAA
TCACTATCTTGAAGGGATTGAGATCCATGTCGGTGAGCGGCATTACTCGCTGCCTAAATCCAGTTTTAAA
TGTGTGGGGTTTGCCAGTGGTGATGGCATTTTACCTTACCCTCAAAATGTCTATGAAGGGTATCGTATTT
TACAGGAGTATCTCTCATTTTCTGATGCATTTATGTTCTTTGATATCTGTAATATTTATAAATGCTTACC
CAGTGATTTAACCGGTAACTTCTCCATTAAGTTAATGTTTTCTCGCACATTACCAGCAGATGTATTGATT
AAGGATGAGTCTTTTCAGCTCTATTGTGTTCCTGTACTCAACCTTTTTTCACATGATGCAGATCCGATCG
ATCTTACTGGTAAAAAAATAGAGTATCCCATTGCACCATCGAGTCGAAAACCATCACATTTTGAGATATT
TAGTGTCGATAAAGTGCAAGGTTGGGTCGATTCAGACGCTGGACGTTTTCGTGGTGAAGAGCGTGTCTAT
ACCCCCTTTGAAAGCTTCCAGCATGAGATTGAGCGGGCTCGTGAGCGTGTGGCACTTTATTACCGTTTAA
GAGTAAAAGAGAGTATTCGTGAAGATGGCTTCGACCACTTTATCTCTTTTGTCAGAGGCGATGAGACTCA
AAGCTTTGATGTCAGTGAAGCGGTGTCGATTAGTTTAACTTGCACGAATCGTCAGCTACCGACCAAATTA
GGCAAAGGTGATATCTGCGTTGCTACCGACAGCTCACCTAATTTTGCCACCTTTAAGAATATTACAGAAC
CAAATGCATCCCTTCGTCCTGTTCTCGATGGCAGCATGCTATGGACCTTAATCTCTAATTTGTCATTGAA
CTACCTTTCATTGCTATCTAAAGATGCCTTGTGCTCGATTATTCGAGCCTATGATTTTAAATCTTTGATT
GACAGACAAGCTGAGCGGATCACGCAGAAAAGGCTTGATGGGATAGTGAGTATTGAGTCAAAGCCGACAG
AGCGAATATTACGTGGTATGCCAGTGCGCGGCTTGATGTCCGAAATCGTGCTTGATCAAAAGTACTTTGG
TTCTGAAGGCGATCTATATCTATTTGCCACTGTACTTAGCCGATTTTTTGCACTCTACGCCAGCATCAAC
TCATTTCACCAGTTAGTAGTGATTAATGCAGCTAATCAAGAAAGGTACACATGGGATATTCAGATAGGTC
AACAGCCACTGATTTAA
 Primer design