SecReT6
Protein ID: 170726873
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2527
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3089055..3089480 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB1KGT5
KEGG IDswd:Swoo_2527
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.80E-20, Aligned region: 34..124
Protein Sequence: 141 a.a.     [Download]
>gi|170726873|ref|YP_001760899.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MFNHDDTFGVSFFQRLGDENEHASNGSESIEYVIASIKRNISGLLNTRVGESQSCPELGLFDFNDANSGS
FDLGVRIKAGIKTCIERFEPRLTHLDIRVLHDTSCPFSLRFHIHGKINVKTAQEKIEIDLFLDSNRTYRV
S
 
Nucleotide Sequence: 426 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3089480-3089055 Shewanella woodyi ATCC 51908 chromosome, complete genome
TTGTTTAATCATGACGACACTTTTGGAGTGAGCTTTTTTCAACGCTTAGGTGATGAAAATGAGCACGCTT
CAAATGGATCTGAATCCATTGAATATGTCATCGCTTCGATTAAACGCAATATCTCTGGCCTGCTAAATAC
GCGGGTCGGAGAGTCTCAAAGTTGTCCTGAACTTGGATTGTTTGATTTTAATGACGCCAATTCAGGAAGC
TTTGATTTAGGCGTTAGGATCAAAGCAGGCATAAAGACATGCATTGAGCGTTTCGAACCGCGACTCACTC
ATTTAGATATTCGTGTTTTGCACGATACTAGTTGTCCATTCAGTTTGCGATTTCATATCCACGGAAAAAT
TAACGTTAAAACGGCTCAGGAAAAGATCGAAATAGATCTCTTTTTGGATAGTAACCGAACGTATAGGGTA
AGTTAG
 Primer design