SecReT6
Protein ID: 170726874
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2528
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3089487..3090962 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1KGT6
KEGG IDswd:Swoo_2528
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.90E-189, Aligned region: 64..489
Protein Sequence: 491 a.a.     [Download]
>gi|170726874|ref|YP_001760900.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MESMETAQESSQVLNGNLLDEILAQTKITPIDEGYDVAKKGVAAFISNILETESNSEPINKALVDKMLVE
LDKKISSQMDQILHDESVQQMESSWRNLKLLVDRTDFRENIKIEVLHVTKSELLDDFEFAPETVQSGLYK
HVYSSGYGQFGGEPIGAIVGNYAFTPSSQDMKLLQYVSAVGAMAHAPFLSSVGPEFFGIDSFEELPNLKD
LKSTFESPKYTKWRSLRESEDARYLGLTAPRFLLRVPYDPIDNPIGSFNYRESVHASHEDYLWGNTAFAL
ATRLTESFAKYRWCPNIIGPQSGGAVDDLPVHVFESMGALQSKIPTEVLITDRKEFELADEGFISLTMRK
GSDNAAFFSANSIQKPKVFPNTKEGKEAETNYKLGTQIPYMMIINRLAHYIKVLQREQIGSWKERQDLER
ELNSWIKQFVADQENPPADVRSRRPLRAAKVEVMDVQGDPGWYQVSMAVRPHFKYMGANFELSLVGRLDQ
E
 
Nucleotide Sequence: 1476 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3090962-3089487 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGGAATCAATGGAAACAGCGCAGGAAAGTAGTCAGGTATTAAATGGTAATCTTCTAGATGAGATTTTGG
CTCAAACCAAGATAACACCTATCGATGAAGGCTATGATGTTGCTAAAAAAGGGGTCGCTGCCTTTATCAG
CAATATTCTTGAAACAGAATCTAACAGCGAGCCTATCAATAAAGCGCTTGTTGATAAAATGCTGGTCGAG
TTAGATAAAAAGATTAGTAGTCAGATGGATCAAATTCTTCATGATGAATCTGTTCAACAGATGGAGTCAT
CGTGGAGAAATTTAAAGTTATTAGTTGATAGAACTGACTTTAGAGAAAATATAAAGATTGAAGTTCTCCA
TGTAACAAAAAGTGAGTTACTTGACGATTTTGAGTTTGCACCGGAAACGGTTCAATCGGGTCTTTACAAG
CACGTATACTCTTCGGGTTATGGTCAGTTTGGTGGTGAGCCGATAGGGGCTATTGTGGGTAATTATGCCT
TTACGCCATCTTCTCAAGATATGAAGCTGTTGCAGTATGTCTCAGCGGTTGGCGCGATGGCTCATGCACC
TTTCTTATCCTCCGTTGGCCCTGAGTTTTTTGGTATTGATTCGTTTGAAGAGTTACCGAATTTAAAAGAT
CTAAAATCAACATTTGAAAGCCCTAAATACACTAAGTGGCGCTCATTAAGAGAGTCTGAAGATGCAAGGT
ACTTGGGGCTAACAGCGCCTAGATTCCTACTGCGTGTTCCCTATGATCCTATTGATAACCCAATTGGTTC
ATTTAACTATCGTGAAAGTGTTCATGCAAGCCACGAAGATTACCTTTGGGGTAACACAGCATTTGCTTTA
GCAACACGATTGACCGAAAGCTTCGCTAAGTACCGCTGGTGCCCAAATATTATTGGCCCACAAAGCGGTG
GCGCCGTTGACGATCTTCCTGTTCATGTCTTTGAATCGATGGGGGCACTGCAGTCAAAAATTCCGACAGA
AGTACTCATCACCGATCGCAAAGAGTTTGAACTTGCTGACGAAGGTTTTATTAGCCTTACCATGCGCAAA
GGTAGCGACAATGCAGCGTTTTTCTCAGCTAACTCAATCCAAAAGCCAAAAGTGTTTCCGAATACCAAAG
AGGGCAAGGAGGCTGAGACCAACTACAAGTTAGGCACTCAGATCCCTTACATGATGATTATCAATCGTCT
AGCTCACTACATTAAGGTATTGCAGCGTGAGCAGATCGGTTCATGGAAAGAGCGTCAAGATCTTGAGCGA
GAGCTCAATAGTTGGATTAAACAGTTTGTCGCTGATCAGGAAAATCCACCAGCAGATGTCAGAAGCCGTA
GACCACTACGTGCAGCTAAAGTCGAAGTGATGGATGTACAGGGCGATCCAGGATGGTATCAGGTCTCGAT
GGCGGTTCGACCGCACTTCAAATACATGGGAGCTAACTTCGAACTCTCTTTGGTTGGACGTCTAGACCAG
GAGTAA
 Primer design