SecReT6
Protein ID: 170726875
SecReT6 ID263
T6SS typei1
Gene symbol-
Locus tagSwoo_2529
StrainShewanella woodyi ATCC 51908
Repliconchromosome [GenBank: NC_010506] [Browse all T6SS(s) in this replicon]
Location [Strand]3091052..3091540 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDB1KGT7
KEGG IDswd:Swoo_2529
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.80E-57, Aligned region: 6..158
Protein Sequence: 162 a.a.     [Download]
>gi|170726875|ref|YP_001760901.1| unnamed protein product [Shewanella woodyi ATCC 51908]
MAKDGTVAPKERINIKYVPSTGDQQAEMELPLKMLIVGDFKGHAEDTQLEERQSVSVNKTNFESIMKESG
LSVNTTVANKLTDNESDELNVELNFSSMKDFSPDAIATQVPEINKLIELREALVALKGPLGNIPSFRTKL
QELIETEDSREQLLAELQTLDN
 
Nucleotide Sequence: 489 bp     [Download]
>gi|170724370|ref|NC_010506.1|:c3091540-3091052 Shewanella woodyi ATCC 51908 chromosome, complete genome
ATGGCAAAAGATGGCACAGTTGCGCCTAAAGAACGTATTAATATTAAATATGTTCCCTCTACAGGTGATC
AACAGGCGGAAATGGAACTTCCACTCAAGATGTTGATTGTGGGTGATTTTAAAGGTCACGCAGAAGATAC
ACAGCTTGAAGAAAGACAATCAGTATCTGTAAATAAAACAAACTTCGAATCAATAATGAAAGAAAGCGGC
CTATCTGTTAATACAACGGTTGCGAATAAATTAACTGACAATGAATCTGACGAGTTAAATGTAGAATTAA
ACTTCAGTTCCATGAAAGATTTCTCTCCTGATGCCATCGCTACACAAGTCCCTGAAATAAACAAACTCAT
TGAGCTAAGAGAAGCCCTTGTCGCTTTAAAAGGCCCATTAGGTAATATCCCATCATTTAGAACCAAGCTG
CAGGAATTGATTGAGACCGAGGATTCTCGTGAACAACTTTTAGCAGAACTTCAAACTCTAGATAACTAG
 Primer design