SecReT6
Protein ID: 170731812
SecReT6 ID264
T6SS typei4b
Gene symbol-
Locus tagBcenmc03_0459
StrainBurkholderia cenocepacia MC0-3
Repliconchromosome I [GenBank: NC_010508] [Browse all T6SS(s) in this replicon]
Location [Strand]497489..501433 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB1JUQ1
KEGG IDbcm:Bcenmc03_0459
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.60E-71, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 2.40E-52, Aligned region: 498..877
DUF1215 [PF06744], Evalue: 1.50E-29, Aligned region: 1010..1125
Protein Sequence: 1314 a.a.     [Download]
>gi|170731812|ref|YP_001763759.1| type VI secretion protein IcmF [Burkholderia cenocepacia MC0-3]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMLQLPLLWAALAFAAVLALWLVVALWRRWRVKRANQQLG
QVLEEQAETGKIAAPAAAALAPDAKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDDKRDVVAQFDTHFEELYEGLKEISVAQLSLSRGNQLSPGQLSFPLEFSTIKP
SLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDGSALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDIIEDRIEQLEQFRRDKPLSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVQGGTLPVSTNAAGAAPQAGAMLAASGTAPAAAPQQAATPQGGLYSDAS
PTNVQDAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIRSAERMISFYLSRVNDD
DWPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQGLVAGSYAIPGT
FTREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIA
VQGFTSFGQAVDGMNRLGDPQDSPIRKILETAYDQTSWDNPSLANVTIKKAQTGVVNWVKQLFTHSQAGQ
MAAANIDINGNPAEVPMGPIGQEFVGLARIVATHDGTSMLKGYMESLSKVRTRFNVIKNQGDPGPGARQL
MQQTLDGNGSELADSLKLVDEQMLTGLTDSQRKSLRPLLVRPLMQAFAVVIQPASAEVNKVWNAQVYQPF
QSSLATKYPFAANAKVEAGAGEIAQVFGPDGSIAKFVGTTLGPLAVRRGDTLAARTWGDMGIGLTPDFTN
GFARWVAPLAGGAAGSAAASAEPQTVFQILPQPSTGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGAP
GATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWAQGSVNVSVTMRIISTSQPSAGGG
DQPQQQSLRGLQLPSSVADASAGAAQNATQAGTGTPGAAPAVAAANATNAQRAQ
 
Nucleotide Sequence: 3945 bp     [Download]
>gi|170731356|ref|NC_010508.1|:c501433-497489 Burkholderia cenocepacia MC0-3 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATCGTCGGGATCGTCGCGCTAGCGG
CCATTCTGTTCATCGTCGCCGACATGCTGCAGTTGCCGCTCCTGTGGGCGGCGCTCGCGTTCGCGGCGGT
TCTCGCGCTGTGGCTCGTGGTCGCGCTATGGCGCCGCTGGCGCGTGAAGCGCGCGAACCAGCAGCTCGGC
CAGGTGCTGGAAGAGCAGGCGGAAACCGGCAAGATCGCCGCACCGGCCGCCGCCGCGCTCGCGCCGGACG
CGAAGACGGCCGACCTCGACGTGCTGCGCACGCGCCTGTCGGATGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCGGCC
GCGGGCAAGAGCAGCGCCGTGCTCAACTCCGGCCTGCAGTTCCCGTTCGCGGACAAGAACAGCGCGGTGA
TCCATGGCATCGGCGGCACGCGTAACTGCGACTGGTTCTTCACGACCGAAGGGATCCTGCTCGACACGGC
CGGCCGCTATTCGGTGCACGAGGAAGACCGCAGCGAGTGGCTCGGCTTCCTCGGGCTGCTCAAGCGCTAC
CGTCCGAAGGCGCCGATCAACGGCATCATCGTCACGGCCAGCATCGCCGAACTCACCGGCAATCGCCCCG
AATTCGCGATCAACCTCGCGAAGAACCTCCGTCAGCGCGTTCAGGAGCTGACCGAAAAGCTGGAAGTGTT
CGCGCCGGTCTACGTGATGTTCACGAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAGTACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAGCCCGACGACAAGCGTGACGTCG
TCGCCCAGTTCGACACGCACTTCGAGGAGCTCTACGAAGGGCTGAAGGAAATCAGCGTCGCGCAACTGTC
GCTGTCGCGCGGCAACCAGCTGTCGCCGGGCCAGCTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCG
TCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACCAGCGCGCTGCAGGAAGGCGAAACCAACAGCGCGGCCGCGCAGCGCATCGCGCACCGCTT
CGGCCTCGACGGCAGCGCGCTGCCGAAACCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCGAAGGTGATCTTCGCGGACCGTCAGACGGTGCGCCAGTTCGCGAGTCCGACCAAGACGCGGC
TGCGCTACGCAACCTTCTTCGGCTTCGTCGCGGCGCTCGCGCTCGCGCTGGGCGGCTGGACCTGGTCGAC
GATCGGCAACCAGCAGCTCGTCGCGAACGTGCAGGCCGACCTCGACAACGTCACGCGCCTGCAACAGGGC
CGCAACGACCTGCAGTCGCGCCTGCAGGCGATGGACATCATCGAGGACCGGATCGAGCAGCTCGAACAGT
TCCGCCGCGACAAGCCGCTGTCGGTGTCGCTCGGCCTGTACCAGGGCGACCGTCTCGAGCAGCACCTGCT
GACCGAGTACTACAACGGCGTGCGCCAGATCCTGCTGGCCCCGGTGTCGCAGAACCTCGCGTCGTTCATG
AAGGACGTGAACGCGCACCCCGAGCAGCTCGTGCCGATGACGCGCCCGCCCGAATCGGGCGCCGTGCAGG
GCGGCACGCTGCCGGTCTCGACGAACGCGGCAGGCGCCGCGCCGCAAGCGGGCGCCATGCTGGCCGCGTC
CGGCACCGCGCCGGCCGCCGCCCCGCAACAGGCGGCCACGCCGCAGGGCGGCCTCTACAGCGACGCGTCG
CCGACCAACGTGCAGGACGCGTACAACGCGCTGAAGACCTACCTGATGCTGTCCGACAAGCGTCACGTCG
AACAGGCGCACCTGACCGACCAGCTCGCCCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAACAT
GCCGCGCGACGAGATGATCCGGAGCGCCGAGCGCATGATCTCGTTCTACCTGTCGCGCGTGAACGACGAC
GACTGGCCGATGATCGACGCGAACCTCGCGCTCGTCGACCAGACCCGCGAGAATCTGCGCCGCGTCGTAC
GCGGCATGCCGGCCCGCCAGCGCGTGTACGAGGAAATCAAGGCCCGTGCGTCGACCCGCTTCGCGCCGAT
GACCATCGCGCGTATCGTCGGCGACGGCAACCAGGGGCTCGTGGCAGGCAGCTACGCGATTCCGGGCACG
TTCACGCGCGAAGCGTGGTTCGACTACGTGCAGCCGGCGATCCGCGATGCGGCGACCAAGGAGCTGCAGG
CGAAGGACTGGGTGCTCAACACGTCGACGCAGGACGACCTGACGCTCGAGGGCAGCCCCGAGCAGATCCA
GAAGACGCTCGTCGGCATGTACAAGACCGAGTACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCG
GTACAGGGCTTCACCAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCTTGGGCGACCCGCAGGATTCGC
CGATCCGCAAGATCCTCGAGACCGCGTACGACCAGACGTCGTGGGACAACCCGTCGCTCGCGAACGTGAC
GATCAAGAAGGCGCAGACAGGCGTCGTGAACTGGGTCAAGCAACTGTTCACGCACTCGCAGGCCGGCCAG
ATGGCGGCAGCCAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGCCCGATCGGCCAGGAAT
TCGTCGGGCTCGCGCGGATCGTCGCGACGCATGACGGCACGTCGATGCTGAAGGGCTACATGGAGTCGCT
GTCGAAGGTCCGCACGCGCTTCAACGTGATCAAGAACCAGGGCGACCCGGGGCCGGGCGCGCGCCAGCTG
ATGCAGCAGACGCTCGACGGCAACGGTTCGGAACTCGCCGATTCGCTCAAGCTCGTCGACGAGCAGATGC
TGACGGGCCTGACCGATTCGCAACGCAAGTCGCTGCGCCCGCTGCTGGTGCGGCCGCTGATGCAGGCGTT
CGCGGTCGTGATCCAGCCGGCCAGCGCCGAAGTCAACAAGGTGTGGAACGCGCAGGTCTACCAGCCGTTC
CAGAGCTCGCTCGCGACCAAGTACCCGTTCGCGGCGAACGCGAAGGTCGAGGCCGGCGCCGGCGAGATCG
CGCAGGTGTTCGGCCCGGACGGCTCGATCGCGAAGTTCGTCGGCACGACGCTCGGGCCACTCGCGGTGCG
CCGCGGCGACACGCTCGCCGCCCGCACGTGGGGCGACATGGGCATCGGGCTCACGCCGGACTTCACGAAC
GGTTTCGCACGCTGGGTCGCGCCGCTCGCGGGCGGCGCCGCCGGCAGCGCGGCCGCGTCGGCCGAGCCGC
AGACCGTGTTCCAGATCCTGCCGCAACCGAGCACGGGCACGACGGAATACACGATCGCGATCGACGGCCA
GCAGCTGCGCTACCGCAACACGCCGCCGCAGTGGACCAACTTCGTGTGGCCGAACCCGCAGGGCGCGCCG
GGCGCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGGTGCAGCTCGTCAACGAGCCGGGCCGCTACG
GTCTCGAGAAGCTGATCAACTCGGCGCAGCGCAAGCGCCGTCCGGACGGCACCTTCGACCTGACGTGGGC
ACAGGGCAGCGTGAACGTGTCGGTGACGATGCGCATCATCAGCACGTCGCAACCGTCGGCCGGTGGCGGC
GACCAGCCGCAGCAGCAGAGCCTGCGCGGCCTGCAGCTGCCGTCGTCGGTCGCCGACGCGAGCGCGGGCG
CCGCGCAGAACGCGACGCAAGCCGGCACCGGTACGCCGGGCGCCGCGCCGGCCGTCGCGGCCGCCAACGC
AACGAATGCACAGAGGGCGCAATGA
 Primer design