SecReT6
Protein ID: 171060725
SecReT6 ID265
T6SS typei3
Gene symbol-
Locus tagLcho_4057
StrainLeptothrix cholodnii SP-6
Repliconchromosome [GenBank: NC_010524] [Browse all T6SS(s) in this replicon]
Location [Strand]4543591..4547253 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB1XWW0
KEGG IDlch:Lcho_4057
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.00E-94, Aligned region: 227..487
IcmF-related [PF06761], Evalue: 3.80E-93, Aligned region: 304..364
IcmF-related [PF06761], Evalue: 3.80E-93, Aligned region: 537..851
DUF1215 [PF06744], Evalue: 7.40E-25, Aligned region: 961..1080
Protein Sequence: 1220 a.a.     [Download]
>gi|171060725|ref|YP_001793074.1| type VI secretion protein IcmF [Leptothrix cholodnii SP-6]
MKTLLGWIFNRWTLAVVALLALSLLIWIVGPLIAVAEVRPLDSTRSRLMLIGCLVLALLLMAAWSAWQAR
RANRSVVEQLMKPAAGGAPAGSESPDVAAMRQRFERALQVLREARFPSASTAAGGAPVGAIDARGKPAAP
KPGLLARLGLQNLGGRYLYQLPWYLIIGAPGSGKTTALRNAGLQFPLAELTGEHRVRGVGGTRDCDWWFT
DRAVLIDTAGRFTTQDSDAGRDQGAWSGFLGLLRQSRPRQPINGVLVTVSVPDLLGRSAAERDDYAARVR
LRLQELHKQLGVRFPVYLLVTKVDLLNGFGDYFATLDKDSRATPWGTTFTLAQSRSGDHTALAPELKALT
QRLQDGLVERLQAETDPQRRARIYGFPLQFGSLHEPLDAFVRDAFAPSPFEPPSLLRGVYFVSGTQEGTP
IDRLMGSIARSWQLERAILPPQGASARSYFLERLLGEVVFAEAGLAGTDPRGERRRRLMLVGAYAALGLL
TAGALAAWATSAVNNRNYVDAVLARVDEVRRLVQATPNRASPDLQPLLPALAATRQLAQAGWGDAAVPWS
LGFGLFQGDKLDAASRSAYQRMLVDAVLPRLALRIEEQLRQRADAPELQYESLKAYLMLHDPQRFDADAL
AALVRADWAQNLPREVGTAEREQLDQHLDALLALGPAVSPLPQDQALVTQTRALLAAVPLPQRIYNRLRH
QGLGEQVAEFTAARAGGPAAALVFARASGAPLTRGVPGLYTRDGYQQGFQRKVDAVTRELADEETWVLGN
AANGGGGAAGQATRPSAATLADDVRRLYLTDYANTWEAFIADVRLRPTQSLAELVQVTRVLSGPDNPLAT
LLKAVVRETTLLGGEEPGAVKAAADRARGAVAAVREGIRALGGDAAAAALPARGVPLESIVDDRFAMLRR
YVQAAPGARAPIDDTLVLLNEVQLHLASVELAVRSANPPPPSDLPVRLGAEGARSAEPVRSLLGTLGRSS
AGFTGLMQREVLSREVRSMVGDFCTQAVAGRYPLRSGSATDVTLADFGQLFGPGGRFDRLFQEKLAAHVD
TSARPTWRFRANGLGEDAGTLAQFQRAQVIRDTFFPAGGNTPQLRLEFKPVEMDASISQFVLDIDGQVVR
YAHGPQIPTSVQWPGPRGTNQVRLQLSPAGASGNGLLNEGPWALLHLFDRVQLEPGRSAERFRATFELDG
RKAVFEITASSVRNPLRLRELAEFSCPNGL
 
Nucleotide Sequence: 3663 bp     [Download]
>gi|171056692|ref|NC_010524.1|:4543591-4547253 Leptothrix cholodnii SP-6 chromosome, complete genome
ATGAAGACGCTGCTGGGCTGGATCTTCAACCGCTGGACGCTCGCCGTCGTCGCGCTGCTGGCGCTGTCGC
TGCTGATCTGGATCGTCGGCCCGCTGATCGCGGTGGCCGAGGTGCGCCCGCTCGACAGCACGCGCTCGCG
GCTGATGCTGATCGGCTGCCTCGTGCTGGCGCTGCTGCTGATGGCGGCGTGGAGCGCCTGGCAGGCCCGC
CGCGCCAACCGGTCGGTGGTCGAGCAGCTGATGAAGCCCGCCGCCGGCGGTGCGCCGGCCGGCAGCGAGT
CACCCGACGTGGCCGCGATGCGCCAGCGCTTCGAGCGCGCGCTGCAGGTGCTGCGCGAGGCGCGGTTCCC
GTCGGCGTCGACCGCGGCCGGCGGCGCCCCGGTCGGTGCGATCGACGCGCGTGGCAAACCCGCCGCGCCC
AAGCCCGGCCTGCTGGCGCGCCTGGGGCTGCAGAACCTGGGCGGGCGCTACCTCTACCAGCTGCCCTGGT
ACCTGATCATCGGCGCGCCCGGCTCGGGCAAGACCACCGCGCTGCGCAACGCCGGTCTGCAGTTCCCGCT
GGCCGAGCTGACCGGCGAACACCGCGTGCGCGGCGTCGGCGGCACGCGCGACTGCGACTGGTGGTTCACC
GACCGCGCGGTGCTGATCGACACCGCCGGCCGCTTCACCACGCAGGACAGCGACGCCGGGCGCGACCAGG
GCGCGTGGAGCGGCTTCCTCGGCCTGCTGCGCCAGTCGCGGCCGCGCCAGCCGATCAACGGCGTGCTCGT
CACCGTGTCGGTGCCCGACCTGCTCGGCCGCAGCGCCGCCGAGCGCGACGACTACGCCGCTCGCGTGCGC
CTGCGCCTGCAGGAGCTGCACAAGCAGCTGGGCGTGCGTTTCCCGGTCTACCTGCTGGTCACCAAGGTCG
ACCTGCTCAACGGCTTCGGCGACTATTTCGCCACCCTCGACAAGGACAGCCGCGCCACGCCCTGGGGCAC
CACCTTCACGCTGGCGCAGTCACGCAGCGGCGACCACACGGCCCTGGCCCCCGAGCTGAAGGCGCTGACC
CAGCGCCTGCAGGACGGCCTGGTCGAGCGCCTGCAGGCCGAGACCGACCCGCAGCGGCGCGCCCGCATCT
ACGGCTTTCCGCTGCAGTTCGGCAGCCTGCACGAGCCGCTCGACGCCTTCGTGCGCGACGCCTTCGCGCC
CTCGCCGTTCGAGCCGCCGAGCCTGCTGCGCGGCGTGTACTTTGTCAGCGGCACGCAGGAAGGCACGCCG
ATCGACCGCCTGATGGGCTCGATCGCGCGCAGCTGGCAGCTCGAACGCGCGATCCTGCCGCCGCAGGGCG
CCAGCGCGCGCAGCTACTTCCTGGAGCGCCTGCTCGGCGAGGTGGTGTTCGCCGAGGCCGGCCTGGCCGG
CACCGATCCGCGCGGCGAACGGCGCCGTCGCCTGATGCTGGTGGGCGCCTACGCCGCGCTCGGCCTGCTG
ACGGCGGGCGCGCTGGCGGCCTGGGCGACCAGCGCGGTCAACAACCGCAACTACGTCGACGCCGTGCTGG
CGCGGGTCGACGAGGTGCGCCGGCTGGTGCAGGCCACGCCCAACCGTGCCAGCCCCGACCTGCAGCCGCT
GCTGCCGGCGCTGGCCGCCACCCGCCAGCTGGCGCAGGCCGGCTGGGGCGACGCGGCGGTGCCGTGGTCG
CTCGGCTTCGGGCTGTTCCAGGGCGACAAGCTCGACGCCGCCTCGCGCAGCGCCTATCAGCGCATGCTGG
TCGACGCCGTGCTGCCGCGCCTGGCGCTGCGCATCGAGGAGCAGCTGCGCCAGCGCGCCGACGCGCCCGA
GCTGCAGTACGAATCGCTCAAGGCCTACCTGATGCTGCACGACCCGCAGCGCTTCGACGCCGACGCGCTG
GCCGCGCTGGTGCGCGCCGACTGGGCGCAGAACCTGCCGCGCGAGGTCGGCACGGCCGAGCGCGAGCAGC
TCGACCAGCACCTCGACGCCCTGCTCGCGCTCGGCCCCGCCGTCTCGCCGCTGCCGCAGGACCAGGCGCT
GGTGACGCAGACCCGCGCCCTGCTCGCCGCCGTGCCGCTGCCCCAGCGCATCTACAACCGCCTGCGTCAC
CAGGGCCTGGGCGAGCAGGTGGCCGAGTTCACCGCCGCCCGCGCCGGCGGGCCGGCCGCGGCGCTGGTGT
TCGCGCGCGCCAGCGGCGCCCCGCTGACGCGCGGCGTGCCCGGGCTCTATACGCGTGACGGCTACCAGCA
GGGCTTCCAGCGCAAGGTCGACGCCGTCACCCGCGAACTGGCGGATGAAGAAACCTGGGTTCTTGGGAAC
GCCGCCAATGGCGGCGGCGGCGCTGCGGGCCAGGCCACCCGCCCGAGCGCCGCCACGCTGGCCGACGACG
TGCGCCGCCTGTACCTGACCGACTACGCCAACACCTGGGAGGCCTTCATCGCCGACGTGCGCCTGCGCCC
GACCCAGAGCCTGGCCGAGCTGGTGCAGGTCACGCGCGTGCTGTCCGGCCCCGACAACCCGCTGGCCACG
CTGCTGAAGGCGGTGGTGCGCGAGACCACGCTGCTCGGCGGCGAGGAGCCCGGCGCCGTCAAGGCCGCCG
CCGACCGCGCGCGTGGTGCGGTGGCCGCGGTGCGCGAGGGCATCCGCGCGCTCGGCGGCGATGCGGCCGC
CGCCGCGCTGCCCGCGCGCGGTGTGCCGCTCGAATCGATCGTCGACGACCGCTTCGCGATGCTGCGCCGC
TACGTGCAGGCCGCGCCGGGTGCGCGCGCACCGATCGACGACACCCTCGTGCTGCTCAACGAGGTGCAGC
TGCACCTGGCCAGCGTCGAGCTGGCGGTGCGCAGCGCCAACCCGCCGCCGCCGTCGGACCTGCCGGTGCG
CCTGGGCGCCGAGGGCGCACGCTCGGCCGAGCCGGTGCGCAGCCTGCTCGGCACGCTGGGCCGCAGCAGC
GCCGGCTTCACCGGGCTGATGCAGCGCGAGGTGCTGTCGCGCGAGGTGCGCTCGATGGTGGGCGACTTCT
GCACGCAGGCCGTGGCCGGGCGCTACCCGCTCAGGAGCGGCTCGGCCACCGACGTCACGCTGGCGGATTT
CGGCCAGCTGTTCGGACCGGGCGGGCGCTTCGACCGGCTGTTCCAGGAGAAGCTGGCCGCCCACGTCGAC
ACCTCGGCGCGGCCGACCTGGCGCTTCCGCGCCAACGGGCTGGGCGAGGACGCCGGCACGCTGGCGCAGT
TCCAGCGCGCGCAGGTCATCCGCGACACCTTCTTCCCGGCCGGCGGCAACACGCCGCAGCTGCGGCTGGA
GTTCAAGCCGGTCGAGATGGACGCCAGCATCAGCCAGTTCGTGCTCGACATCGACGGCCAGGTGGTGCGC
TACGCCCACGGCCCGCAGATCCCGACCAGCGTGCAATGGCCCGGCCCGCGCGGCACCAACCAGGTGCGGC
TGCAGCTCAGCCCCGCCGGCGCCAGCGGCAACGGCCTGCTCAACGAAGGCCCGTGGGCGCTGCTGCACCT
GTTCGACCGCGTGCAGCTCGAACCCGGCCGCAGCGCCGAGCGCTTTCGCGCCACCTTCGAGCTCGACGGC
CGCAAGGCGGTGTTCGAGATCACCGCCAGCAGCGTGCGCAACCCGCTGCGCCTGCGCGAGCTGGCCGAGT
TCAGCTGCCCGAACGGCCTGTGA
 Primer design