SecReT6
Protein ID: 172059446
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0383
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]430361..433534 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB1YS80
KEGG IDbac:BamMC406_0383
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.10E-70, Aligned region: 42..353
Phage_GPD [PF05954], Evalue: 3.10E-70, Aligned region: 583..649
DUF2345 [PF10106], Evalue: 1.90E-60, Aligned region: 667..820
DUF2345 [PF10106], Evalue: 1.90E-60, Aligned region: 944..1009
T6SS_Vgr [PF13296], Evalue: 1.50E-36, Aligned region: 524..630
Phage_base_V [PF04717], Evalue: 1.70E-20, Aligned region: 424..514
Phage_base_V [PF04717], Evalue: 1.70E-20, Aligned region: 875..894
Phage_base_V [PF04717], Evalue: 1.70E-20, Aligned region: 950..966
Sarcoglycan_1 [PF04790], Evalue: 0.0033, Aligned region: 714..785
Protein Sequence: 1057 a.a.     [Download]
>gi|172059446|ref|YP_001807098.1| ImpA family type VI secretion-associated protein [Burkholderia ambifaria MC40-6]
MNMQNTIAALRGGLLQQDRLLKLDTPLGANVLTVQRAVGRSRIGRAYEFTLDVLSADGDLELKKLIAQPV
TLWIQQGDRSYRPVNGYVHTARRLGADGGLTTYQLTFADFTHFLKFRRDQRLWNDTSVDQIISDVLNQHP
QAQGHFRFALSKPLPSRSYTRQHDTDWHFVHRLMESEGLYSTWQQADDGKSHTLVITDNLQAFASLSPET
LRFYRGGAASEADAFTQWSGTRTLQSVTRTTRTFDYKNPSQPSNPKGTTLPTMGGQGELPDQLEVYEYTG
AYTYLDQTRGDHLTKIHMEEWESQAKRFHGAGGVRAIDAGRRFVLSDHPEHDRDPADQREFAAIGVEWWI
ENNLPVASSSADFPYSLREALTQAQEGYGADPAFRVPHDDGSVGFYLVEVEAQRVSVPYRSPFEHEKPKM
HLETAIVVGPQGEEVYTDALNRIRVQFVWDRLNPGNENASCWVRVVQSDTGGGYGGVHVPRIGEEVLIDY
VGGDCDRPLAVGRVYNGANQPQWHSDGILSGYRSKEYSGGGYNQLVMDDATGQNRVQLMSSSANSLLHLG
YIIDQNGNSRGSYLGSGFDLRSDAYGAVRASQGLYVTTHPKAPNSQPLDVKEAQQQLVTGESLVEAMSGV
SEQHQAESLKDAQDTMRAFTDATQNNVSGNTSGGRTADGGTGSANAFKEPVMLFGSPSGIGMSTQQSLHM
VANDHVNVASGQSVHVAAGKSLIGSIGQKLSLFVQNAGMKLFAGKGKVEIQAQSDNVEVTAQKAVKVVSA
TDRIEIAADQGILLTSGGGYIRIQGGNIEIHTPGAVDVKGASHTFAGPASMGYPLPSPRPDQPGQLELFH
KYVNGEAVKGGLFTVKDVNGAVLKKGALDNSGYTVVSGLPPGAVRVEFGKDPRESDQPANYFKQAKWPAE
PVEPSPEAAQAAASGQLASQLQGMAPAATTAAMGLVSGGSAGAALGGLASSALPAAASALGGAGAASALQ
TASSLSGAAKQVAGMVQAARQGGLAALAAPAANAASGALQGALPGVAGIAGKGATTVASAAGGMKLPTPG
FGGPLKS
 
Nucleotide Sequence: 3174 bp     [Download]
>gi|172059067|ref|NC_010551.1|:430361-433534 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAACATGCAGAATACGATTGCCGCATTGCGCGGCGGGTTGCTTCAGCAGGACCGGCTGCTGAAGCTCG
ATACGCCATTGGGGGCCAACGTGCTGACCGTGCAGCGTGCGGTCGGCCGTTCGCGCATCGGGCGCGCATA
CGAATTCACGCTCGACGTGCTGTCGGCCGATGGTGATCTGGAACTCAAAAAACTGATCGCGCAGCCCGTC
ACGTTGTGGATCCAGCAAGGCGATCGCAGCTACCGGCCGGTCAACGGCTACGTCCATACCGCGCGCCGCC
TCGGCGCCGACGGCGGGCTCACGACCTATCAGCTCACGTTCGCCGATTTCACCCATTTCCTGAAGTTTCG
TCGCGACCAGCGCCTCTGGAACGACACGAGCGTCGATCAGATCATCAGCGATGTGCTGAATCAGCATCCG
CAGGCGCAGGGGCATTTTCGGTTCGCGCTGTCGAAGCCGCTGCCGAGCCGGTCATACACGCGTCAGCACG
ATACCGACTGGCATTTCGTGCACCGGCTGATGGAAAGCGAAGGCCTCTACAGCACGTGGCAGCAGGCCGA
CGACGGCAAGTCGCATACGCTCGTGATCACCGACAACCTGCAAGCGTTCGCGTCGCTGTCGCCGGAAACC
CTGCGCTTCTATCGTGGCGGCGCGGCGAGCGAAGCCGACGCGTTCACGCAATGGTCGGGCACGCGCACGC
TGCAGAGCGTGACGCGGACGACGCGCACGTTCGACTACAAGAATCCATCGCAACCGTCGAACCCGAAGGG
CACGACGCTGCCGACGATGGGTGGCCAGGGCGAATTGCCCGATCAGCTCGAGGTCTACGAGTACACCGGG
GCGTACACCTATCTGGACCAGACGCGCGGCGACCATCTGACGAAGATCCACATGGAGGAATGGGAGTCGC
AGGCGAAGCGCTTCCATGGCGCGGGCGGCGTGCGCGCGATCGATGCCGGCCGGCGCTTCGTGCTGTCGGA
TCATCCCGAGCACGATCGCGATCCGGCAGACCAGCGCGAGTTCGCAGCGATCGGTGTCGAGTGGTGGATC
GAGAACAACTTGCCCGTCGCGAGCAGCAGCGCGGACTTTCCGTACAGCCTGCGCGAAGCGTTGACGCAAG
CGCAGGAGGGCTACGGTGCCGATCCCGCGTTTCGCGTGCCGCATGACGATGGCTCGGTCGGTTTCTACCT
CGTCGAAGTCGAAGCGCAGCGTGTGAGCGTGCCGTATCGCAGCCCGTTCGAGCACGAGAAGCCGAAGATG
CATCTCGAGACGGCGATCGTCGTCGGGCCGCAGGGCGAGGAAGTCTATACCGACGCGTTGAACCGGATCC
GCGTGCAGTTCGTGTGGGACCGTCTGAACCCGGGCAACGAGAACGCGTCGTGCTGGGTGCGCGTGGTGCA
GTCGGATACCGGTGGCGGCTACGGCGGCGTGCATGTGCCGCGCATCGGCGAGGAAGTGCTGATCGACTAT
GTCGGTGGCGATTGCGACCGGCCGCTTGCGGTCGGGCGCGTGTACAACGGCGCGAACCAGCCGCAGTGGC
ACTCCGACGGGATTCTGTCCGGATACCGGTCGAAAGAGTATTCGGGCGGCGGCTACAACCAGCTCGTGAT
GGACGACGCGACCGGGCAGAACCGCGTGCAACTGATGAGCAGCAGCGCGAACAGCCTGCTGCATCTGGGC
TACATCATCGACCAGAACGGCAATTCGCGCGGCTCGTATCTGGGCAGCGGGTTCGACCTGCGCTCGGATG
CGTATGGCGCGGTGCGGGCGAGCCAGGGCCTGTACGTCACCACCCATCCGAAGGCGCCAAACAGCCAGCC
GCTCGACGTGAAGGAAGCGCAGCAGCAGCTCGTGACGGGCGAGAGCCTGGTCGAGGCGATGTCGGGCGTG
AGCGAGCAGCATCAGGCGGAGAGCCTGAAGGACGCGCAAGACACGATGCGCGCGTTCACCGACGCAACGC
AGAACAACGTATCGGGCAACACGTCCGGCGGGCGAACGGCAGACGGCGGCACGGGCAGCGCGAACGCATT
CAAGGAGCCGGTGATGCTGTTCGGCAGCCCGTCAGGGATCGGGATGTCGACGCAGCAGTCGCTGCACATG
GTCGCGAACGATCACGTGAACGTCGCGAGCGGACAGAGCGTACATGTCGCGGCGGGCAAGTCGCTGATCG
GCAGCATCGGGCAGAAGCTGAGCCTGTTCGTGCAGAACGCGGGGATGAAGCTGTTCGCGGGCAAGGGCAA
AGTCGAGATCCAGGCGCAGTCGGACAACGTCGAGGTGACCGCGCAGAAGGCTGTGAAGGTTGTGTCCGCA
ACCGACCGCATCGAGATCGCGGCCGATCAAGGGATTCTGTTGACCAGCGGCGGCGGGTATATCCGCATCC
AGGGCGGCAACATCGAGATTCATACGCCGGGCGCGGTGGACGTGAAGGGCGCGTCGCATACGTTCGCGGG
GCCGGCGAGCATGGGTTATCCGTTGCCGAGCCCGCGGCCGGATCAGCCGGGGCAGCTCGAGCTGTTTCAC
AAGTACGTGAACGGCGAGGCCGTGAAGGGTGGGTTGTTCACGGTGAAAGACGTGAACGGCGCCGTGCTGA
AGAAGGGCGCGCTCGACAACAGCGGCTATACGGTGGTGAGCGGCTTGCCGCCCGGCGCGGTACGCGTCGA
GTTCGGAAAGGACCCGCGCGAGTCGGACCAGCCGGCGAATTACTTCAAGCAGGCGAAGTGGCCGGCAGAG
CCGGTCGAACCGTCGCCGGAAGCCGCGCAGGCAGCGGCGAGCGGTCAGCTCGCGAGCCAGTTGCAGGGAA
TGGCGCCCGCGGCGACCACGGCGGCGATGGGGCTCGTGAGTGGCGGCAGCGCGGGCGCTGCGCTCGGCGG
GCTCGCGAGTTCCGCATTGCCGGCTGCCGCGAGTGCGCTCGGTGGAGCGGGCGCCGCGTCGGCGTTGCAG
ACGGCTTCCAGCCTGAGCGGTGCAGCGAAGCAGGTGGCCGGGATGGTGCAGGCCGCACGTCAGGGTGGGC
TTGCGGCGCTGGCCGCGCCGGCCGCGAATGCCGCGTCCGGAGCGCTGCAGGGAGCGTTGCCCGGCGTCGC
TGGAATCGCGGGCAAGGGCGCCACGACGGTGGCGTCAGCGGCGGGCGGCATGAAGCTGCCGACCCCCGGG
TTTGGCGGACCGCTGAAATCCTGA
 Primer design