SecReT6
Protein ID: 172059459
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0398
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]446554..447336 [-]
Producthypothetical protein
NoteTssL
UniProt IDB1YS93
KEGG IDbac:BamMC406_0398
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.90E-58, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|172059459|ref|YP_001807111.1| hypothetical protein BamMC406_0398 [Burkholderia ambifaria MC40-6]
MSYAPSLFGDNTPAPLQTPASTDAAFQARSLVDLLYDGFFMLFLLKNGREPDSASEFSTKIQEFLSDFER
GAKKLNIAAEDVYAAKFAYCAAVDEMVLSSQFKIRTDWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAPFAPHWPLPDQIAHRLKREVPVW
AIGAVFALVALLGYLGLNTYLKDKTLQALAPYSQVVKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c447336-446554 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAGCTACGCGCCCTCCCTGTTCGGCGACAACACGCCGGCACCGCTGCAGACCCCGGCGTCGACCGACG
CCGCGTTCCAGGCCCGTTCGCTGGTCGACCTGCTGTACGACGGGTTCTTCATGCTGTTCCTGCTCAAGAA
CGGTCGCGAGCCGGACAGCGCGAGCGAGTTCAGCACGAAGATCCAGGAATTCCTGTCGGATTTCGAGCGC
GGCGCGAAGAAGCTGAATATCGCCGCGGAAGACGTGTACGCCGCGAAGTTCGCGTATTGCGCGGCGGTCG
ATGAAATGGTGCTGTCGTCGCAGTTCAAGATCCGGACAGACTGGGAGCGCCGGCCGCTGCAGCTCGTGCT
GTTCGGCGAGCAGCTCGCGGGGGAGAAGTTCTTTCAGTATCTCGAGGAATGCCGCGCGCAGGGCGCGGCG
CGGTTGCAGTCGCTCGAGGTGTTTCATATGTGCCTGCTGCTCGGGTTCCAGGGCAAGTATCTGCTCGAGG
GGCCGGAGAAGCTGGCTTACCTCACCGCGCGGCTGGGCGACGAGATCGCGCATATGAAAGGCAAGCGCGC
GCCGTTCGCGCCGCATTGGCCGCTGCCCGATCAGATCGCGCATCGGTTGAAGCGCGAGGTGCCGGTTTGG
GCGATCGGGGCGGTGTTCGCGCTGGTCGCGCTGCTGGGGTATCTCGGGCTCAATACGTATCTGAAGGACA
AGACGCTGCAGGCGTTGGCGCCTTATTCGCAAGTCGTCAAGGTCGGCCCGGAGTCTGCGAATTTGACGAT
TTCGTTGCCTTGA
 Primer design