SecReT6
Protein ID: 172059460
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0399
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]447333..448679 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB1YS94
KEGG IDbac:BamMC406_0399
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-134, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|172059460|ref|YP_001807112.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGVRSVRIDRDALGSNVLRVAELALVFP
DGALYAAPQADDLPPPIALDTLPDGINEFVFYLALHPLRENGANYSDDPAAGFMTRFVSEQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEIDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYTLADLPVYRHDDPGPSFARLDLMLRELLDTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPNVELIDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFSLDSRGALYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c448679-447333 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGGGAAGGGCTGTTCCTCCGGCCTCAACACTTTCAGCGGCAGG
ACGCCTACCACGAGGCGCGCCTGTTCGAATCCATCCAGGCGATCCAGCCGTACAACTGGGGCGTGCGCTC
GGTGCGCATCGATCGCGATGCGCTCGGCAGCAACGTGCTGCGCGTGGCCGAGCTCGCGCTCGTGTTCCCG
GACGGCGCGCTGTATGCCGCGCCGCAGGCCGACGACCTGCCGCCGCCGATCGCGCTCGACACGCTGCCCG
ACGGCATCAACGAATTCGTGTTCTACCTCGCGTTGCACCCGCTGCGCGAGAACGGCGCCAACTACAGCGA
CGATCCGGCCGCCGGCTTCATGACGCGTTTCGTCAGCGAGCAGACGAGCGTCGCGGACAACTTCACCGAC
GCCGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGCTGCTGTCGGTGCCGCTCGTGCGCGTGCGCCGCACCGCGACGTCCGGCTTCGAGATCGACGACAGCTT
CGTGCCGCCGTGCCTCGCGATCGAGGCTTCGCCGATCCTGCACCAGCGGTTGCGCCAACTGGTCGACGCG
CTGCAGGCGAAGGTCAACGCGCTGTACGGTTTTCACCGCGAGCCGTCGAAGAACATCATCGAGTTCCGCT
CGGGCGACATCGCGTCGTTCTGGCTGCTGCACACCGCGAATGCCGCGTTCGCGACGCTCGCGCACTTGCA
CCAGCATGCGGCGCTGCATCCGGAACGACTGTTCCAGGAACTGCTGCGCCTCGCGGGGCAATTGATGACG
TTCTCGAAGGGCTATACGCTCGCCGATCTCCCCGTGTATCGCCACGACGATCCGGGCCCGAGCTTCGCGC
GTCTCGACCTGATGCTGCGCGAGCTGCTCGACACAGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
CGAGGTGCGTCCGTCGTTCCACCTCGGCCGCCTCGATTCCGGCAAGATCGACGACAAGACCGAGTTCTAC
CTTGCCGTGTCCGCGGACATGCCGAACGTCGAGCTCATCGATGCCGTGCCGGCCCGCTTCAAGGTCGGTG
CGCCCGACGACGTCGACAAGCTCGTGCTGTCTGCGATGCCCGGCGTGCGGCTGTCGTACACGCCGCAGGT
GCCGCCCGCGATCCCCGTGCGGCCGGGCGCGTGCTATTTCTCGCTCGATTCGCGCGGCGCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCCGCGATGATCTACGCGCCGACTGGCATCAATGACCTGAAATTCGAACTGA
TCGCGGTCACCTCATGA
 Primer design