SecReT6
Protein ID: 172059461
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0400
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]448784..449392 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB1YS95
KEGG IDbac:BamMC406_0400
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.60E-37, Aligned region: 14..174
Protein Sequence: 202 a.a.     [Download]
>gi|172059461|ref|YP_001807113.1| hypothetical protein BamMC406_0400 [Burkholderia ambifaria MC40-6]
MRSMIRHALPLLACALLAGCAAAPLLGSAASAVLQAAGVGKPELPDAQKPPRNIGLTLAAASNLNAANDR
KPLALVVRLYALKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLIPGQRYTATEKVSREAQAFGIV
ALFRDPAIQRWKLTFDPAKSEKSGIIIGLHNCAMTVTDGSVIAPQQGAPSQPLNLLSSVSCG
 
Nucleotide Sequence: 609 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c449392-448784 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAGATCAATGATTCGCCATGCGCTGCCGCTGCTTGCCTGCGCGCTCCTGGCCGGGTGCGCGGCCGCCC
CGTTGCTCGGCTCTGCCGCGAGCGCCGTGCTGCAGGCTGCCGGCGTGGGCAAGCCCGAACTGCCGGATGC
CCAGAAGCCCCCGCGCAACATCGGGCTCACGCTCGCCGCCGCGTCCAACCTCAATGCCGCGAACGATCGC
AAGCCGCTCGCATTAGTGGTAAGACTCTACGCGCTGAAGGATCCGACGTCGTTCCAGCAGGCGCCGTTCG
ACGCGTTCACCGATCCGACCAAGGAAAAGGCCGCGCTGGGCGCCGATCTGCTGAACGTGCGTGAAATCAC
GCTGATTCCGGGCCAGCGCTATACCGCGACCGAAAAGGTATCGCGCGAAGCGCAGGCATTCGGCATCGTC
GCGCTGTTCCGCGATCCCGCCATCCAGCGATGGAAACTGACGTTCGACCCGGCGAAGTCGGAGAAATCCG
GCATAATCATCGGCCTGCATAATTGCGCGATGACGGTGACCGATGGCTCCGTGATCGCCCCGCAACAAGG
GGCGCCTTCGCAACCGCTGAATTTGCTTTCGTCCGTCAGCTGCGGTTAA
 Primer design