SecReT6
Protein ID: 172059463
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0402
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]450452..450967 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB1YS97
KEGG IDbac:BamMC406_0402
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.10E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|172059463|ref|YP_001807115.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVGDLAGQSEIEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFSPDEVVEQVEPLRRLLDARSKLADLRNKLAGN
DKLEDLLSEVLKNTQQLQELAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|172059067|ref|NC_010551.1|:450452-450967 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGGCCAAGAAAGAAAGCATTCAGAAAAGCTTGCAGAAAATTCGGCCGCCGCGCGTCCAATTGACCTACG
AGGTCGAGAAGGGCGACGCGATCGAGGTGAAGGAACTGCCGTTCGTCGTCGGGGTCGTCGGCGATCTGGC
GGGCCAGTCGGAAATCGAGCAGCCGAAGCTGCGCGACCGCAAGTTCGTCAATATCGACCGCGACAACTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCCGCGTTTCAGGTGGAAAACCGCCTGAGCCCGGAAGGCG
GCAAGTTCGCGGTCGACCTGAAGTTCCGTTCGCTGTCGGATTTCAGCCCGGACGAAGTCGTCGAACAGGT
CGAGCCGCTGCGCCGCCTGCTCGACGCGCGTTCGAAGCTCGCCGACCTGCGCAACAAGCTCGCCGGCAAC
GACAAGCTCGAGGATCTGCTGTCGGAAGTGCTGAAGAACACGCAGCAGCTGCAGGAGCTCGCGAAGGGCA
CGGGCGGCGACAAAGACGGCGAATGA
 Primer design