SecReT6
Protein ID: 172059464
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0403
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]450983..452473 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1YS98
KEGG IDbac:BamMC406_0403
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.00E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|172059464|ref|YP_001807116.1| EvpB family type VI secretion protein [Burkholderia ambifaria MC40-6]
MNQQTAAAQASGAEYAAGTSLLDDIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVIVSDNLSATIDAR
VAELDRLISTQLSAVMHAPEFQRLESTWRGMDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFSDLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGQTAENFNFVEDVDGTEHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNASQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|172059067|ref|NC_010551.1|:450983-452473 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAAGCGAGCGGCGCGGAATACGCCGCCGGGACTTCGTTGCTCGACG
ACATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGTGCGAAGGACCTGATCGGCGA
ACTCGTGCACCAGGTGCTCGACGGTACTGTGATCGTGTCGGACAACCTGTCGGCGACGATCGACGCGCGC
GTCGCGGAGCTCGACCGCCTGATCTCCACGCAGCTCTCCGCGGTGATGCATGCGCCGGAATTCCAGCGCC
TGGAAAGCACGTGGCGCGGGATGGACTACCTGGTCAAGGAAAGCAACACGGGCCAGACGATCAAGATCAA
GGCGCTGCACGCCCCGAAGCGCGACCTCGTGCGCGACTTCAAGGGCGCGAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAAGAGTTCGGCACGTTCGGCGGCTCGCCGTTCGGTGCGCTGATCGGCG
ACTACGAGATCTCGCGCCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCACGTCGCGGCGGCCGC
GCATGCGCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTCGGCCTCGAGTCGTTCTCCGACCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGACACGGTCGAATACGCGAAGTGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCGGAGAACTTCAACTTCGTCGAGGATGTGGACGGCACCGAGCACGACAAGTACCTGTGGTGCAAC
GCGGCGTGGGCGTTCGCGGCACGCCTGACCGCCGCGTTCGACGACTTCGGCTGGTGCGCGGCGATCCGCG
GCGTCGAAGGCGGTGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGTGAAGTCGC
GCTGAAGTGCCCGACCGAAATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGACCTCGGCTTCATC
CCGCTCGTTCATTGCAAGAACTCGGATTACGCTGCGTTCTTCGCCGCGCAATCGGTGCAGAAACCGAAAA
AATACAGCACCGACAGCGCGAATGCGAATGCCGTCCTGTCCGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTCGCGCACTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCATCGGCGCAGAACGTG
GAGACTTTCCTCAACCGGTGGATTTCGCAGTACGTCCTGCTCGACGACAACGCATCGCAGGAACAGAAGG
CGCAATTCCCGCTGCGCGAGGCATCCATACAAGTGTCAGAGATTCCGGGGAAGCCGGGCTCGTATCGTTC
GGTCGCGTTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA
 Primer design