SecReT6
Protein ID: 172059465
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0404
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]452544..453047 [+]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDB1YS99
KEGG IDbac:BamMC406_0404
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.70E-43, Aligned region: 7..139
Protein Sequence: 167 a.a.     [Download]
>gi|172059465|ref|YP_001807117.1| Hcp1 family type VI secretion system effector [Burkholderia ambifaria MC40-6]
MLHMHLQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVREEGLPLETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|172059067|ref|NC_010551.1|:452544-453047 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGTTACATATGCACTTGCAGTTTGGTAGTCCCGCGGTGAAGGGCGAGTCCGCGGACAAGGACCACCAGG
GCTGGATCGAGCTGAAATCGTGGGATCACTCGATCGTTCAACCGCGTTCGGCAACCGCATCGACCGCTGG
CGGTCACACGATGACGCGTTGCGAGCACGGCGACATGATTTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTACCAACACGCTTCGGGCGGCACCACGTTCGACGAGGTGACGGTCCATTTCTCGCGCGCTGACG
GTGAAGGCAAGCGCGTGCAGTATCTGGAAGTCAAGCTCAAGTACGTGATCATCTCGAGCATCGCCCCGAG
CGTTCGCGAGGAAGGTCTGCCGCTCGAGACGTTCTCGCTGAAGTACGCAGCTGTGCAGTGGAAGCAAACC
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGTCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA
 Primer design