SecReT6
Protein ID: 172059466
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0405
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]453110..453595 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB1YSA0
KEGG IDbac:BamMC406_0405
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.50E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|172059466|ref|YP_001807118.1| type VI secretion system lysozyme-like protein [Burkholderia ambifaria MC40-6]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTELELAELPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQSTNALYFAIQALLVVHPAEEPVNFD
AMLQPSTLQYSVTRTRAARML
 
Nucleotide Sequence: 486 bp     [Download]
>gi|172059067|ref|NC_010551.1|:453110-453595 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAAACGATTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCACCTGCCGGCCTCGGCAG
CGATGCGGCAATTGTCGCTGGACGAGCTCAAGAACACGGTTGCCCGCGACGTCGAGGCGATCCTCAACAC
CCGTATCGCGCACACCGAACTCGAACTGGCGGAGCTGCCGGAATGCCAGAAGTCGGTGCTGACCTACGGG
CTGAACGATTTCGCGGGGCTGAGCCTCGCGAGTCATTACGACCGCGCGTTCATCTGCAAGTCGATCCAGC
AGGCCATTGCGCGCCATGAGCCGCGGTTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGTCGAC
CAACGCGCTTTACTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCGGCCGAGGAGCCGGTGAATTTCGAC
GCGATGCTGCAGCCGTCGACGCTGCAGTATTCGGTCACGCGCACACGCGCGGCAAGAATGCTGTGA
 Primer design