SecReT6
Protein ID: 172059467
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0406
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]453673..455508 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDB1YSA1
KEGG IDbac:BamMC406_0406
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-215, Aligned region: 4..610
Protein Sequence: 611 a.a.     [Download]
>gi|172059467|ref|YP_001807119.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MEELLPYYERELSFLRRYSRDFAERYPKIAARLALSGEHCEDPHVERMIESFALLGARINKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSIAQFTPASPGQQTEPVVIDRGTELKSRPIRGVQCRFRTAYDVTLAPIRIS
EARYMPVALAPSATVLPSNATGVISITFESLAAQLDLGALKLPTLRAHLHGEQSFVAALTDCLFVNVLGA
YVEPERNGRWTALRKLPIAHAGFDEDDALIDYPAKSHPAYRLLTEYFAFPDKFDFVDFDVAAIARAAGRC
QRATLHLVLQDVRSDSHVARLLELLTASHFRLFCTPIVNLFRQHGEPIRITHRAVSYPVIAEARRAFAYE
VYSIDSVKLVRQQAHEESVIEFRPFYSLHHGESARIGHYWFARRNDWVAQKSPGYETEISIVDIDFEPTS
PQTDTLSLDLTCTNRDLPSMLAFGLEGGDLFQEGGAQTSGISLLRRPTQSVRFERGRAAHWRLVSHLALN
HVSLVAHGLAPLKEMLTLYDLRRTAVSMRQIDGLVGVEQRGAVQWLPGKPFATFVRGIEIRLTIDEEHFV
GASLASFVRVLDSFFGLYVHLNSFVQLVVVSKRTGEEIIRCKPRTGESILA
 
Nucleotide Sequence: 1836 bp     [Download]
>gi|172059067|ref|NC_010551.1|:453673-455508 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGGAAGAATTGCTGCCGTATTACGAGCGCGAATTATCGTTTTTGCGGCGCTATTCGCGAGATTTCGCCG
AACGCTATCCGAAGATCGCCGCGCGGCTCGCGTTGTCCGGCGAGCACTGCGAGGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCGCGCTGCTGGGCGCGCGCATCAACAAGAAGCTCGACGACGACTACCCGGAATTC
ACCGAAGCGCTGCTGGAAGTGCTGTATCCGCACTACCTGCGGCCGTTCCCGTCGTGCTCGATCGCGCAAT
TCACGCCGGCTTCGCCCGGCCAGCAGACCGAACCGGTCGTGATCGACCGCGGCACCGAGCTGAAGAGCCG
TCCGATCCGCGGCGTGCAGTGCCGGTTCCGCACCGCGTACGACGTGACGCTCGCGCCGATCCGCATTTCG
GAGGCGCGCTACATGCCGGTCGCGCTCGCGCCGAGCGCGACGGTGCTGCCGTCCAACGCGACGGGCGTGA
TCTCGATCACGTTCGAATCGCTTGCCGCGCAGCTCGATCTCGGCGCGCTGAAGCTGCCGACGCTGCGCGC
GCACCTGCACGGCGAACAGTCGTTCGTCGCCGCGCTGACCGACTGCCTGTTCGTCAACGTGCTCGGCGCG
TATGTCGAGCCCGAGCGCAACGGCCGCTGGACCGCGCTGCGCAAGCTGCCGATCGCGCACGCCGGCTTCG
ACGAGGACGACGCGCTGATCGACTACCCGGCGAAGTCGCACCCCGCCTATCGCCTGCTCACCGAATACTT
CGCATTCCCCGACAAGTTCGATTTCGTCGATTTCGACGTCGCGGCGATCGCGCGCGCGGCGGGCCGCTGC
CAGCGCGCGACGCTGCATCTGGTGCTGCAGGACGTGCGCAGCGATTCGCACGTCGCGCGGCTGCTCGAGC
TGCTGACGGCCAGCCATTTCCGGCTGTTCTGCACGCCGATCGTCAACCTGTTCCGCCAGCACGGCGAGCC
GATCCGCATCACGCACCGCGCTGTGTCGTACCCGGTGATCGCCGAAGCGCGCCGGGCGTTCGCGTACGAG
GTGTATTCGATCGATTCGGTGAAGCTCGTCCGGCAGCAGGCGCACGAGGAATCGGTGATCGAGTTCCGGC
CGTTCTATTCGCTGCATCACGGCGAATCGGCGCGGATCGGTCATTACTGGTTCGCGCGCCGCAACGACTG
GGTCGCGCAGAAAAGCCCCGGATACGAAACGGAGATCTCGATCGTCGACATCGACTTCGAGCCGACGTCG
CCGCAGACCGACACGCTGAGCCTCGACCTCACCTGCACGAACCGCGATCTGCCGTCGATGCTCGCGTTCG
GCCTCGAAGGCGGCGACCTGTTCCAGGAAGGCGGCGCGCAGACGAGCGGCATCTCGCTGCTGCGGCGCCC
GACCCAGAGCGTGCGTTTCGAGCGCGGCCGCGCCGCGCACTGGCGGCTCGTGTCGCACCTCGCGCTGAAC
CACGTGTCGCTGGTCGCGCACGGGCTCGCGCCGCTCAAGGAAATGCTGACGCTGTACGACCTGCGGCGCA
CCGCCGTGTCGATGCGCCAGATCGACGGCCTCGTCGGCGTCGAGCAGCGCGGCGCCGTGCAGTGGCTGCC
CGGCAAGCCGTTCGCGACCTTCGTGCGCGGCATCGAGATCCGGCTGACGATCGACGAGGAGCACTTCGTC
GGCGCGAGCCTCGCGTCGTTCGTGCGCGTGCTCGACAGCTTCTTCGGGCTGTATGTCCACCTCAACAGTT
TCGTTCAACTAGTCGTGGTGTCGAAGCGCACCGGCGAGGAGATCATCCGATGCAAGCCCCGAACCGGCGA
ATCGATCCTGGCGTAG
 Primer design