SecReT6
Protein ID: 172059468
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0407
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]455472..456572 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDB1YSA2
KEGG IDbac:BamMC406_0407
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.70E-95, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|172059468|ref|YP_001807120.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MQAPNRRIDPGVVDALLDEPHRFEFFQAVRVLEGLFARQASDAPGAWRQGDVVAQHIEFRNTLSLGFPPS
EIEGARSFHDGGALLDSGDERDAALAAGELGHVELTPAFFGLLGAQGALPLHYTEQIVAREHLKRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDEIRDNLAAGAGGVLDEAVAGYA
LAARHRPMSAAYLQRALSDYFRVPVKIDQFVGKWYDVPPDQLSVLGEVNVVLGATALVGERVWQRDMRAR
IVVGPLSKRDYEAFLPGGAHAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
ALHDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|172059067|ref|NC_010551.1|:455472-456572 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGCAAGCCCCGAACCGGCGAATCGATCCTGGCGTAGTCGACGCGCTGCTCGACGAGCCGCACCGCTTCG
AATTCTTCCAGGCGGTGCGCGTGCTCGAAGGGCTGTTCGCACGGCAGGCGTCCGATGCGCCCGGCGCATG
GCGGCAGGGCGACGTCGTCGCGCAGCACATCGAATTCCGCAACACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAAGGCGCGCGCTCGTTCCACGACGGCGGCGCGCTGCTCGATTCGGGGGATGAACGCGACGCCG
CGCTCGCGGCCGGCGAGCTCGGTCACGTCGAGCTGACGCCGGCGTTCTTCGGACTGCTCGGCGCTCAGGG
CGCGCTGCCGCTGCACTACACCGAGCAGATCGTCGCGCGCGAGCACCTGAAGCGCGACCACGCGGCGCGC
GCGTTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTATGCGGCGTGGAAGAAATACCGGCTGC
CGTTCCATTACGAACTCGATCGCGACGAGCGCTACCTGCCGCTCTTGCTCGCGATCGCCGGCGTGCCGAG
CGACGAGATCCGCGACAACCTCGCGGCCGGCGCGGGAGGCGTGCTCGACGAGGCCGTCGCCGGCTACGCG
CTCGCCGCGCGGCACCGGCCGATGTCGGCCGCGTACCTGCAGCGCGCGCTGTCCGACTACTTCCGCGTGC
CGGTGAAGATCGATCAGTTCGTCGGCAAATGGTACGACGTGCCGCCCGACCAGTTGAGCGTGCTCGGCGA
GGTCAACGTGGTGCTCGGCGCGACGGCGCTCGTCGGCGAACGTGTGTGGCAGCGCGACATGCGCGCGCGG
ATCGTCGTCGGCCCGCTGTCCAAGCGCGACTACGAGGCGTTCCTGCCCGGCGGCGCGCACGCCGTCGCGC
TCGAACGGATGCTGACGCTGCTCGCCGGCGTCACGCTCGAATACGAGGTGAAGCTCGTGCTGAAGCGCAC
CGAGGTGGGCGCGAGCGTGCTCGGCGCAGGCTCGCGGCTCGGCTGGGACGCGTTCCTCTGCACGCGCGAC
GCGCTCCACGACCGCTCGGACGCCCGCTACGAACTGCACGTGATTCACTGA
 Primer design