SecReT6
Protein ID: 172059469
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0408
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]456616..459285 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1YSA3
KEGG IDbac:BamMC406_0408
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.20E-44, Aligned region: 231..330
AAA_2 [PF07724], Evalue: 2.20E-44, Aligned region: 619..787
AAA [PF00004], Evalue: 2.90E-19, Aligned region: 232..345
AAA [PF00004], Evalue: 2.90E-19, Aligned region: 478..513
AAA [PF00004], Evalue: 2.90E-19, Aligned region: 624..741
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 306..362
AAA_5 [PF07728], Evalue: 1.90E-13, Aligned region: 623..743
ClpB_D2-small [PF10431], Evalue: 1.10E-11, Aligned region: 794..867
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 40..77
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 209..256
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 482..529
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 603..659
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 690..712
AAA_16 [PF13191], Evalue: 3.60E-11, Aligned region: 789..833
Clp_N [PF02861], Evalue: 1.30E-09, Aligned region: 23..74
Clp_N [PF02861], Evalue: 1.30E-09, Aligned region: 113..131
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 620..643
AAA_22 [PF13401], Evalue: 8.10E-07, Aligned region: 685..717
Sigma54_activat [PF00158], Evalue: 2.30E-06, Aligned region: 214..249
Sigma54_activat [PF00158], Evalue: 2.30E-06, Aligned region: 621..740
AAA_17 [PF13207], Evalue: 3.20E-05, Aligned region: 233..302
AAA_17 [PF13207], Evalue: 3.20E-05, Aligned region: 623..659
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 216..253
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 623..641
IstB_IS21 [PF01695], Evalue: 0.00017, Aligned region: 798..834
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 284..339
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 621..660
Arch_ATPase [PF01637], Evalue: 0.00028, Aligned region: 694..718
AAA_19 [PF13245], Evalue: 0.00052, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 0.00052, Aligned region: 620..645
AAA_29 [PF13555], Evalue: 0.00062, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 0.00062, Aligned region: 619..648
SRP54 [PF00448], Evalue: 0.0013, Aligned region: 232..253
SRP54 [PF00448], Evalue: 0.0013, Aligned region: 622..655
Zeta_toxin [PF06414], Evalue: 0.0015, Aligned region: 231..252
Zeta_toxin [PF06414], Evalue: 0.0015, Aligned region: 613..663
NACHT [PF05729], Evalue: 0.0016, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.0016, Aligned region: 381..461
NACHT [PF05729], Evalue: 0.0016, Aligned region: 624..644
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 233..366
AAA_14 [PF13173], Evalue: 0.0017, Aligned region: 622..704
AAA_30 [PF13604], Evalue: 0.0024, Aligned region: 217..309
AAA_30 [PF13604], Evalue: 0.0024, Aligned region: 619..647
MobB [PF03205], Evalue: 0.0025, Aligned region: 233..256
MobB [PF03205], Evalue: 0.0025, Aligned region: 622..655
RNA_helicase [PF00910], Evalue: 0.0079, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0079, Aligned region: 624..645
ResIII [PF04851], Evalue: 0.0084, Aligned region: 219..252
ResIII [PF04851], Evalue: 0.0084, Aligned region: 296..314
ResIII [PF04851], Evalue: 0.0084, Aligned region: 595..644
AAA_18 [PF13238], Evalue: 0.0085, Aligned region: 234..252
AAA_18 [PF13238], Evalue: 0.0085, Aligned region: 625..650
Protein Sequence: 889 a.a.     [Download]
>gi|172059469|ref|YP_001807121.1| type VI secretion ATPase [Burkholderia ambifaria MC40-6]
MSTPLKTLITKLNPLCRHATERAASACLARGHYEVDLEHLFLALLDEATGDLPLALRASRVDPHALRADL
ERELTRLKTGNTRTPVFSVHLIALFEQAWLIASLDSQLGRIRSGHLLLALLTAPDLAQFAQRMSPQFAEM
NVTDLKHKFDEIMGGSSEAEPRQPDAEDGDVAPAANGAAPAAGPSKTPALDTYTTNLTQRARDGKIDPVI
GREAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLSGVALHVLDMGLLQAGASV
KGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKVEEPSEPLAAAMLRGMSGLMEKHFNVRILDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAHSATPAAIDDTKKRIERIDAEIASLERESAGGASHDERLGELRGARDTALAQLAENE
ARYEAERVIVAEITELRDTLDKARGPSEDGEPVDVPATREKLAERVAALHALQGGEPMVPLQVDGHVVAE
IVAAWTGIPLGRMVKDEIDTVLNLQPLLGARVIGQDHALDAIAQRVRTATANLEDPNKPRGVFMFVGPSG
VGKTETALALADILYGGERKMVTINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDE
VEKAHPDVLEMFFQVFDKGTMDDAEGREIDFRNTLIILTSNVGSAAVMQACLNKPAEELPDPDALAEALR
PQLYKTFKPAFLGRMKVVPYYPISDDVLAEIIELKLERIRRRIDANHKAAFEWDESLVDAVLARCTEVDS
GARNVDHILNGTLLPEIAGHVLGRIADGAAIARIAVRADEAGEFAYTVE
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|172059067|ref|NC_010551.1|:456616-459285 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGAGCACGCCTCTGAAGACCCTGATCACGAAACTGAACCCGCTGTGCCGGCACGCGACCGAGCGTGCGG
CGAGCGCGTGCCTGGCGCGCGGCCATTACGAGGTCGATCTGGAGCACCTGTTCCTCGCGCTGCTCGACGA
AGCGACGGGCGACCTGCCGCTCGCGCTGCGCGCAAGCCGCGTCGATCCGCATGCGCTGCGTGCCGATCTC
GAGCGCGAGCTCACGCGGCTGAAGACGGGCAACACGCGCACGCCGGTGTTCTCCGTGCATCTGATCGCGC
TGTTCGAGCAGGCGTGGCTGATCGCGTCGCTCGATTCGCAGCTCGGCCGCATCCGCTCGGGGCACCTGCT
GCTCGCGCTGCTGACCGCGCCCGATCTCGCGCAGTTCGCGCAGCGCATGTCGCCGCAGTTCGCGGAAATG
AACGTGACGGACCTGAAGCACAAGTTCGACGAGATCATGGGCGGCTCGAGCGAGGCCGAGCCGCGCCAGC
CGGATGCGGAAGACGGCGACGTCGCGCCGGCTGCCAACGGCGCCGCGCCCGCGGCCGGCCCGTCGAAGAC
GCCCGCGCTCGACACGTACACGACCAACCTCACCCAGCGTGCGCGCGACGGCAAGATCGATCCGGTGATC
GGTCGCGAAGCGGAGATCCGCCAGGCGATCGACATCCTGATGCGCCGCCGCCAGAACAACCCGATCATGA
CCGGCGAGGCCGGCGTCGGCAAAACGGCGGTCGTCGAGGGTCTCGCGTTGCGGATCGCGGCCGACGACGT
GCCGCCGCCGCTCTCCGGCGTCGCGCTGCACGTGCTCGACATGGGCCTGCTGCAGGCCGGCGCGAGCGTG
AAGGGCGAGTTCGAGAACCGTCTGAAGAGCGTGATCGACGAGGTGAAGAAGAGCGCGCATCCGATCATCC
TGTTCATCGACGAGGCACACACGATCATCGGCGCGGGCGGCCAGGCCGGCCAGAACGACGCGGCGAACCT
GCTGAAACCGGCGCTCGCGCGCGGCGAGCTGCGCACGATCGCCGCGACGACGTGGAGCGAATACAAGAAG
TACTTCGAGAAGGATGCGGCGCTGGCGCGGCGTTTCCAGGTCGTGAAGGTCGAGGAGCCGAGCGAGCCGC
TCGCGGCCGCGATGCTGCGCGGGATGTCCGGGCTGATGGAGAAGCACTTCAACGTGCGGATCCTCGACGA
CGCGATCACCGAGGCGGTGCGCCTGTCGCATCGCTACATCAGCGGCCGCCAGCTGCCGGACAAGGCGATC
AGCGTGCTCGACACCGCGTGCGCGAAGGTCGCGCTCGCGCACAGCGCGACGCCGGCGGCGATCGACGACA
CGAAAAAGCGCATCGAGCGCATCGACGCGGAAATCGCGTCGCTGGAGCGCGAATCGGCGGGCGGCGCGTC
GCACGACGAGCGGCTCGGCGAGCTGCGCGGCGCGCGCGACACGGCGCTCGCGCAATTGGCAGAGAACGAA
GCGCGCTATGAAGCCGAGCGCGTGATCGTCGCCGAGATCACCGAACTGCGCGACACGCTCGACAAGGCGC
GCGGCCCGTCGGAAGACGGCGAGCCGGTCGACGTGCCGGCCACCCGCGAGAAGCTGGCCGAGCGCGTCGC
TGCGCTGCACGCGCTGCAGGGCGGTGAGCCGATGGTGCCGCTGCAGGTCGACGGCCACGTCGTCGCCGAG
ATCGTCGCCGCGTGGACCGGCATTCCGCTCGGCCGGATGGTGAAGGACGAGATCGACACCGTGCTGAACC
TGCAGCCGCTGCTGGGCGCGCGCGTGATCGGCCAGGACCATGCGCTGGATGCGATCGCGCAGCGCGTGCG
CACGGCGACCGCGAACCTCGAGGATCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGGCCGTCGGGC
GTCGGCAAGACCGAGACGGCGCTCGCGCTGGCAGACATCCTGTACGGCGGCGAGCGCAAGATGGTCACGA
TCAACATGAGCGAGTACCAGGAAGCGCACAGCGTGTCGGGCCTGAAGGGTTCGCCGCCGGGCTACGTCGG
CTACGGCGAAGGTGGCGTGCTGACCGAGGCCGTGCGCCGCAACCCGTATTCCGTCGTGCTGCTCGACGAG
GTCGAGAAGGCGCACCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCACGATGGACGACG
CCGAAGGGCGCGAGATCGACTTCCGCAACACGCTGATCATCCTGACGTCGAACGTCGGGTCGGCCGCTGT
GATGCAGGCGTGCCTGAACAAGCCGGCCGAGGAGCTGCCCGATCCGGACGCGCTCGCCGAGGCGCTGCGC
CCGCAGCTGTACAAGACGTTCAAGCCCGCGTTCCTCGGTCGGATGAAGGTCGTGCCGTACTACCCGATTT
CCGACGACGTGCTGGCCGAGATCATCGAGCTGAAGCTCGAACGGATCCGCCGCCGCATCGACGCGAACCA
CAAGGCCGCGTTCGAGTGGGACGAATCGCTCGTCGATGCGGTGCTCGCGCGCTGCACCGAGGTCGACTCG
GGCGCCCGCAACGTCGACCACATCCTGAACGGCACGCTGCTGCCGGAGATCGCGGGCCACGTGCTCGGCC
GGATCGCCGACGGCGCGGCCATCGCGCGCATCGCGGTGCGCGCGGACGAGGCCGGCGAATTCGCTTACAC
CGTCGAATGA
 Primer design