SecReT6
Protein ID: 172059470
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0409
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]459325..460446 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDB1YSA4
KEGG IDbac:BamMC406_0409
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.40E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|172059470|ref|YP_001807122.1| ImpA family type VI secretion-associated protein [Burkholderia ambifaria MC40-6]
MPINLPELLTPISDASPSGDDLLFSNEFDAIQDARRYDDPTLDQGEWVTEIKEADWGFVVDHAGELLRTR
TKDLRLAVWLTEALALEDGITGLTEGYALLEGLCRDYWDTVHPLPEGDDVEYRLGNVAWLSGRTAELLRG
IPVTEGASNAFTTLDWEVAQHVAQAVKRDPEHADDIARGKPSVEQVDASRRVTPIAFYTTLLANLKAFEF
SLDAFEERLVERAGDSAPSFRQARDAFETVYRLAERFAREQGYTGSAPHAPSAPQAQPERLEPSFGDAFP
IQETHVQSQTAPRPPMTQMIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQS
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|172059067|ref|NC_010551.1|:459325-460446 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGCCGATCAATCTTCCCGAGCTGCTGACGCCGATCAGCGATGCGTCGCCCAGCGGCGACGACCTGCTGT
TCTCGAACGAATTCGACGCGATCCAGGACGCGCGGCGCTACGACGATCCGACGCTCGACCAGGGCGAGTG
GGTGACCGAGATCAAGGAGGCCGACTGGGGCTTCGTCGTCGATCACGCGGGCGAGCTGCTGCGCACGCGC
ACCAAGGACCTGCGGCTCGCCGTATGGCTGACCGAGGCGCTCGCGCTGGAGGACGGCATCACCGGCCTCA
CCGAAGGCTATGCGCTGCTGGAAGGCCTGTGCCGCGACTATTGGGACACCGTACATCCGCTGCCGGAAGG
CGACGACGTCGAATACCGGCTCGGCAACGTCGCGTGGCTGTCCGGCCGCACGGCCGAGTTGCTGCGCGGC
ATTCCCGTGACGGAAGGCGCGTCGAACGCGTTCACCACGCTCGACTGGGAAGTCGCGCAGCATGTGGCGC
AGGCCGTGAAGCGCGACCCCGAACACGCGGACGACATCGCGCGCGGCAAACCGTCGGTCGAGCAGGTCGA
TGCGTCGCGGCGCGTGACGCCGATCGCGTTCTACACGACGCTGCTCGCGAACCTGAAGGCGTTCGAGTTC
TCGCTCGATGCGTTCGAGGAGCGGCTCGTCGAACGCGCGGGCGATTCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTTCGAAACCGTGTACCGGCTCGCCGAGCGCTTTGCGCGCGAGCAGGGCTATACGGGTAGCGC
GCCGCATGCGCCGTCGGCACCGCAGGCGCAGCCCGAGCGCCTCGAGCCGAGCTTCGGCGACGCGTTCCCC
ATCCAGGAGACCCATGTGCAGTCGCAGACCGCTCCGCGTCCGCCGATGACGCAAATGATCGCCGGCATCC
AGAACCGAGCGCAGGCTGTCGACCAGCTACGCGCCGTCGCGCGTTACTTCCGGCAGACCGAGCCGCACAG
CCCGGTCGCGTATCTCGCGGACAAGGCCGCCGAATGGGCCGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTGAAGGACGACGGGTCGCTGTCGCATATCCGCGAGCTGCTGGGTGTGAGGCCCGACGAGCAGTCGT
GA
 Primer design