SecReT6
Protein ID: 172059479
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0418
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]469588..470538 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDB1YSB3, B1YSB3
KEGG IDbac:BamMC406_0418
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.70E-26, Aligned region: 150..182
OmpA [PF00691], Evalue: 1.70E-26, Aligned region: 214..308
BON [PF04972], Evalue: 0.0001, Aligned region: 87..125
BON [PF04972], Evalue: 0.0001, Aligned region: 159..178
Protein Sequence: 316 a.a.     [Download]
>gi|172059479|ref|YP_001807131.1| OmpA/MotB domain-containing protein [Burkholderia ambifaria MC40-6]
MQRTIHIRRARFSRFVAALVAAGLVGSGAAYAQNTGGATVTPVGNGTVATAALPANSNPAAAPAAGAGTV
VHGTAGTIAPPPANATPGQVVAGGKVPDEATKAAVLQKLRDTYGAANVVDQIEVGDVATPPNWSANVQKL
LGAQLKQISKGQLKINGTQIEVKGEVHNEAQRQQLASDMANTLNPTYTIKNGLRVSASEQGLLDQTLANR
TIEFETGSATLTPQGRQILDQMAAALSKLQNRTVDIIGHTDNSGNRTSNIALSQARADAVKGYLITKSIP
PQQMTTTGVGPDQPIAPNDTAEGRARNRRIEFRVGQ
 
Nucleotide Sequence: 951 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c470538-469588 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGCAACGCACGATTCACATCCGCCGCGCGCGCTTCTCGCGCTTCGTGGCCGCCCTCGTCGCTGCCGGCC
TCGTCGGCAGCGGCGCGGCCTACGCGCAAAATACGGGCGGTGCGACCGTCACGCCGGTCGGCAACGGCAC
GGTCGCGACCGCCGCCCTGCCCGCGAATTCCAACCCCGCCGCCGCGCCGGCCGCGGGGGCCGGCACGGTG
GTGCACGGCACAGCCGGCACGATCGCGCCGCCGCCCGCGAACGCAACGCCCGGCCAGGTGGTGGCCGGCG
GCAAGGTGCCCGACGAGGCGACCAAGGCCGCCGTGCTGCAGAAGCTGCGCGACACCTACGGCGCGGCGAA
CGTCGTCGACCAGATCGAGGTCGGCGACGTCGCGACGCCGCCGAACTGGAGCGCGAACGTGCAGAAACTG
CTCGGCGCGCAGCTCAAGCAGATCAGCAAGGGCCAGTTGAAGATCAACGGCACGCAGATCGAGGTGAAGG
GCGAGGTGCACAACGAGGCGCAGCGCCAGCAGCTCGCGAGCGACATGGCGAACACGCTGAACCCGACGTA
TACGATCAAGAACGGGCTGCGTGTGTCGGCCTCCGAACAGGGGCTGCTCGACCAGACGCTCGCGAACCGC
ACGATCGAGTTCGAGACGGGCAGCGCGACGCTCACGCCGCAAGGCAGGCAGATTCTCGATCAGATGGCCG
CCGCGCTGTCGAAGTTGCAGAACCGCACGGTCGACATCATCGGCCACACCGACAACTCGGGGAACCGGAC
GTCGAACATCGCGCTGAGCCAGGCGCGCGCGGATGCGGTGAAGGGGTATCTGATCACGAAGAGCATTCCG
CCGCAGCAGATGACGACGACGGGAGTCGGCCCGGATCAGCCGATTGCGCCGAATGATACGGCGGAGGGAC
GGGCGAGGAATCGACGGATCGAGTTTCGGGTGGGGCAGTAA
 Primer design