SecReT6
Protein ID: 172059481
SecReT6 ID268
T6SS typei4b
Gene symbol-
Locus tagBamMC406_0420
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]471529..475470 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB1YSB5
KEGG IDbac:BamMC406_0420
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.00E-72, Aligned region: 193..451
IcmF-related [PF06761], Evalue: 2.20E-52, Aligned region: 498..876
DUF1215 [PF06744], Evalue: 6.90E-30, Aligned region: 1009..1124
Protein Sequence: 1313 a.a.     [Download]
>gi|172059481|ref|YP_001807133.1| type VI secretion protein IcmF [Burkholderia ambifaria MC40-6]
MQRILNVLTHPRTLSIVGIVALAAILFIVADMVQLPLLWAALAFAAILVLWLGVALWRRWRVKRANQQLG
QVLEEQAETGKIAAPAAAALAPDSKTADLDVLRTRLSDAVKTIKTSKIGQVSGGSALYELPWYIVIGNPA
AGKSSAVLNSGLQFPFADKNSAVIHGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRSEWLGFLGLLKRY
RPKAPINGIIVTASIAELTGNRPEFAINLAKNLRQRVQELTEKLEVFAPVYVMFTKADLITGFTEFFSSS
DKHEYDRVWGATLPYEPDEKRDVVALFDERFEELYEGLKEISVAQLSLSRGNQLSPGQLSFPLEFSTIKP
SLRAFLATLFENNPFQYKPIFRGFYFTSALQEGETNSAAAQRIAHRFGLDASALPKPHSAFSKNGFFLRD
LFSKVIFADRQTVRQFASPTKTRLRYATFFGFVAALALALGGWTWSTIGNQQLVANVQADLDNVTRLQQG
RNDLQSRLQAMDILEDRIEQLEQFRRDKPVSVSLGLYQGDRLEQHLLTEYYNGVRQILLAPVSQNLASFM
KDVNAHPEQLVPMTRPPESGAVQGGALPVSTNPPGAAPPAGAAQGASAATAAAPQQPAAPQGGLYSDASP
TNVQDAYNALKTYLMLSDKRHVEQAHLTDQLARFWRGWLETNRGNMPRDEMIKSAERMISFYLSRVTDDD
WPMIDANLALVDQTRENLRRVVRGMPARQRVYEEIKARASTRFAPMTIARIVGDGNQGLVAGSYAIPGTF
TREAWFDYVQPAIRDAATKELQAKDWVLNTSTQDDLTLEGSPEQIQKTLVGMYKTEYAQHWQKFMQGIAV
QGFSSFGQAVDGMNRLGDPQDSPIRKILETAYDQTSWDNPSLANVTIKKAQTGVVNWVKQLFTRSQAGQM
AAANIDINGNPAEVPMGPIGQEFIGLARIVATHDGTSMLKGYMDSLSKVRTRFNVIKNQGDPGPGARQLM
QQTLDGNGSELADSLKFVDEQMLTGLTDSQRKSLRPLLVRPLMQAFSVVIQPASAEVNKVWNAQVYQPFQ
SSLATKYPFAANAKVEAGAGEIAQVFGPDGAIAKFVGTTLGPLAVRRGDTLAARTWGDMGIGLTPDFTNG
FARWVAPLAGGAAGGAAAAAEPQTVFQILPQPSTGTTEYTIAIDGQQLRYRNTPPQWTNFVWPNPQGSPG
ATLSATTFDGRTVQLVNEPGRYGLEKLINSAQRKRRPDGTFDLTWVQGSVNVSVTMRIISTSQPTGGGGD
QPQQQSLRGLQLPSSVADASAGAAQNATQAGNGAPAAAPAVTAATATNAQGAQ
 
Nucleotide Sequence: 3942 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c475470-471529 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGCAACGCATCCTCAACGTGCTGACTCATCCGCGTACGCTCTCGATTGTCGGGATCGTCGCGCTAGCGG
CGATTCTCTTCATCGTCGCCGACATGGTGCAGCTGCCGCTCCTGTGGGCGGCGCTCGCCTTCGCGGCGAT
CCTCGTGCTGTGGCTCGGCGTCGCGTTGTGGCGCCGCTGGCGCGTGAAGCGCGCGAACCAGCAACTCGGC
CAGGTGCTGGAGGAGCAGGCGGAAACCGGCAAGATCGCCGCGCCGGCCGCGGCCGCGCTCGCGCCCGACT
CGAAGACCGCCGACCTCGACGTGCTGCGCACGCGCCTGTCCGACGCGGTGAAGACGATCAAGACGTCGAA
GATCGGCCAGGTGTCGGGCGGCTCCGCGCTGTACGAACTGCCGTGGTACATCGTGATCGGCAACCCGGCC
GCGGGCAAGAGCAGCGCCGTGCTGAACTCCGGCCTGCAGTTTCCGTTCGCGGACAAGAACAGCGCCGTGA
TCCACGGCATCGGCGGCACGCGCAACTGCGACTGGTTCTTCACGACCGAGGGGATCCTGCTCGACACGGC
CGGCCGCTACTCGGTGCACGAGGAAGACCGCAGCGAATGGCTCGGCTTCCTCGGCCTGCTCAAGCGCTAC
CGTCCGAAGGCGCCGATCAACGGCATCATCGTCACCGCGAGCATCGCCGAACTCACCGGCAACCGCCCCG
AATTTGCGATCAACCTCGCGAAAAACCTCCGTCAGCGCGTTCAGGAGCTCACGGAAAAGCTCGAGGTGTT
CGCGCCGGTCTACGTGATGTTCACGAAGGCCGACCTGATCACCGGCTTCACCGAATTCTTCAGCAGCAGC
GACAAGCACGAGTACGACCGCGTGTGGGGCGCCACCCTGCCCTACGAACCGGACGAGAAGCGTGACGTGG
TCGCGCTGTTCGACGAGCGCTTCGAGGAACTGTACGAAGGGCTGAAGGAAATCAGCGTCGCGCAGCTGTC
GCTGTCGCGCGGCAACCAGCTGTCGCCCGGCCAGTTGAGCTTCCCGCTCGAATTCTCGACGATCAAGCCG
TCGCTGCGCGCGTTCCTCGCGACGCTGTTCGAGAACAACCCGTTCCAGTACAAGCCGATCTTCCGCGGCT
TCTACTTCACCAGCGCGCTGCAGGAAGGCGAAACCAACAGCGCCGCCGCGCAGCGCATCGCGCACCGCTT
CGGCCTCGACGCGAGCGCGCTGCCGAAGCCGCACAGCGCGTTCTCGAAGAACGGCTTCTTCCTGCGCGAC
CTGTTCTCCAAGGTGATCTTCGCGGATCGCCAGACTGTGCGCCAGTTCGCGAGCCCGACCAAGACCCGGT
TGCGCTACGCGACCTTCTTCGGCTTCGTCGCGGCCCTCGCGCTCGCCCTCGGCGGCTGGACCTGGTCGAC
GATCGGCAACCAGCAGCTCGTCGCGAACGTGCAGGCCGACCTCGACAACGTCACGCGCCTCCAGCAGGGC
CGCAACGACCTGCAGTCGCGCCTGCAGGCAATGGACATCCTGGAAGACCGTATCGAACAGCTCGAGCAGT
TCCGCCGCGACAAGCCGGTATCGGTGTCGCTCGGCCTGTACCAGGGCGACCGTCTCGAGCAGCATCTGCT
GACCGAGTACTACAACGGCGTGCGCCAGATCCTGCTCGCGCCGGTCTCGCAGAACCTCGCGTCGTTCATG
AAGGACGTGAACGCGCACCCCGAACAGCTCGTGCCGATGACGCGCCCGCCCGAATCGGGTGCCGTGCAGG
GCGGCGCGCTGCCGGTCTCGACGAACCCGCCGGGCGCCGCACCGCCGGCCGGCGCCGCGCAAGGCGCATC
CGCCGCGACGGCCGCCGCGCCGCAACAGCCGGCCGCGCCGCAGGGCGGGCTGTACAGCGACGCGTCGCCG
ACCAACGTGCAGGACGCGTACAACGCGCTGAAGACCTACCTGATGCTGTCCGACAAGCGTCATGTCGAAC
AGGCGCACCTGACCGACCAACTCGCCCGCTTCTGGCGCGGCTGGCTCGAGACGAATCGCGGCAACATGCC
GCGCGACGAGATGATCAAGAGCGCCGAGCGCATGATCTCGTTCTATCTGTCGCGCGTGACCGACGATGAC
TGGCCGATGATCGACGCGAACCTCGCGCTCGTCGACCAGACCCGCGAGAACCTGCGCCGCGTCGTGCGCG
GCATGCCGGCCCGCCAGCGCGTCTACGAGGAAATCAAGGCGCGCGCGTCGACCCGTTTCGCGCCGATGAC
CATCGCGCGCATCGTCGGCGACGGCAACCAGGGACTGGTCGCCGGCAGCTACGCGATTCCGGGCACGTTC
ACGCGTGAAGCATGGTTCGACTACGTGCAGCCGGCGATCCGCGACGCGGCGACCAAGGAGCTGCAGGCGA
AGGACTGGGTGCTGAACACGTCGACGCAGGACGACCTGACGCTGGAAGGCAGCCCCGAGCAGATCCAGAA
GACCCTCGTCGGGATGTACAAGACCGAGTACGCGCAGCACTGGCAGAAGTTCATGCAGGGCATCGCGGTG
CAGGGTTTCAGCAGCTTCGGCCAGGCCGTCGACGGGATGAACCGCCTCGGCGACCCGCAGGATTCGCCGA
TCCGCAAGATCCTCGAGACCGCGTACGACCAGACGTCGTGGGACAACCCGTCGCTCGCGAACGTGACGAT
CAAGAAGGCGCAGACGGGTGTCGTGAACTGGGTCAAGCAACTGTTCACGCGCTCGCAGGCCGGCCAGATG
GCGGCCGCGAACATCGACATCAACGGCAATCCGGCCGAGGTGCCGATGGGTCCGATCGGCCAGGAGTTCA
TCGGGCTCGCGCGGATCGTCGCGACGCACGACGGCACGTCGATGCTCAAGGGCTACATGGATTCGCTGTC
GAAGGTGCGCACGCGCTTCAACGTGATCAAGAACCAGGGCGACCCCGGCCCCGGCGCGCGCCAGCTGATG
CAGCAGACGCTCGACGGCAACGGCTCGGAACTCGCCGATTCGCTGAAGTTCGTCGACGAGCAGATGCTGA
CCGGCCTCACCGATTCGCAACGCAAGTCGCTGCGTCCGCTGCTGGTGCGCCCGCTGATGCAGGCGTTCTC
GGTGGTGATCCAGCCGGCCAGCGCCGAAGTCAACAAGGTGTGGAACGCGCAGGTCTACCAGCCGTTCCAG
AGCTCGCTCGCGACGAAGTACCCGTTCGCCGCGAATGCGAAGGTCGAGGCCGGCGCAGGTGAAATCGCGC
AGGTGTTCGGCCCGGACGGTGCGATCGCCAAGTTCGTCGGCACGACGCTGGGGCCGCTCGCGGTGCGCCG
CGGCGACACGCTCGCGGCCCGCACGTGGGGCGACATGGGCATCGGCCTCACGCCTGACTTCACGAACGGC
TTCGCGCGCTGGGTCGCCCCGCTCGCCGGCGGCGCCGCAGGCGGCGCGGCCGCGGCGGCCGAACCGCAGA
CCGTGTTCCAGATCCTGCCGCAGCCGAGCACGGGCACGACGGAATACACGATCGCGATCGACGGCCAGCA
ACTGCGCTACCGCAACACGCCGCCGCAGTGGACCAATTTCGTGTGGCCGAACCCGCAGGGTTCGCCGGGC
GCGACGCTGTCCGCGACGACCTTCGACGGCCGCACGGTGCAGCTCGTCAACGAGCCGGGCCGCTACGGTC
TCGAGAAGCTGATCAACTCCGCGCAGCGCAAGCGCCGCCCGGACGGCACCTTCGACCTCACGTGGGTCCA
GGGCAGCGTGAACGTGTCGGTGACGATGCGTATCATCAGCACGTCGCAGCCGACGGGCGGCGGCGGCGAC
CAGCCGCAGCAGCAGAGCCTGCGCGGCCTGCAGCTCCCGTCGTCGGTCGCCGACGCGAGCGCGGGCGCGG
CACAGAACGCGACGCAGGCCGGCAACGGCGCGCCGGCCGCGGCACCGGCCGTCACGGCCGCCACCGCAAC
GAATGCACAGGGGGCGCAATGA
 Primer design