SecReT6
Protein ID: 172062062
SecReT6 ID269
T6SS typei3
Gene symbol-
Locus tagBamMC406_3022
StrainBurkholderia ambifaria MC40-6
Repliconchromosome I [GenBank: NC_010551] [Browse all T6SS(s) in this replicon]
Location [Strand]3349580..3353488 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDB1YPT4
KEGG IDbac:BamMC406_3022
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.60E-94, Aligned region: 262..541
IcmF-related [PF06761], Evalue: 5.00E-93, Aligned region: 589..913
DUF1215 [PF06744], Evalue: 3.80E-32, Aligned region: 1036..1159
Protein Sequence: 1302 a.a.     [Download]
>gi|172062062|ref|YP_001809714.1| type VI secretion protein IcmF [Burkholderia ambifaria MC40-6]
MSYLKRLFRWLVSWRMLACVAMLLACVAVWFLGPLFVFGELHPFAGAVIRSIVIALLVCLLVLWLRRWPL
SPIWVIALCVALWHVGPLFGFAEHHPLEPIWVRVLIVAAIVFCYAVYGLYKLWQALRSNDALLKRFLEPK
GDQPVEIGRDEVRAVAMVVSKAIAQLKRLRGGTLGWRRWLEVDRHLYGLPWYMMLGTPGAGKTTAILGAG
LQFPLTDQMGAMSAHDIEHTANCDWWFANEAVLIDTAGRYVEQDDAADETATTINAAEWKELLGQLRKHR
PRAPLNGAILTVSVADLVNRSEAERTALAASLRARLGELRQQLGIRFPVYVFVTKLDLLPGFTEYFQSLT
ADGRTQIWGFTLPCDESGEASVDGLRRHCVHELALLEARIDAGVNNRLLEEYESDRRKRLYPLAQEFRGL
SMLVADLVELVFLDSRYDDAQLQNMLRGVYFTSAEQTDQMVAVDRETVLQRLKRKLARLRTVSDTAAQAR
GDGAIAGHRSFFLRNVFQHVIVPEAHLVRADLKWEIRFRTMRWAGHLLTAAVFVWLAFALTVSHENNQNY
LSAIAGKTSALAVHAAAYNKAPKASAIGGLLDRSRDLPRYGDLDLDAPGLAYRYGLYVVPAIVTASDTTY
LSLLKQTLMPQIVSRVESELNTQIAAQNSDDVYRTLAIYLMLYDAERYDAKAVRAWVLRDWERSDSAAAM
GGRNAMTRHLEALFVDERPVTPSMKQDAALVQRARLFLSQNPAPKRLYERAIGAMEKEAPDNFTLAQALG
LQGASLFKLVDGSRFERGVPGLYTYDGYHALFSRRLPEFLARAQADDDWVMGRPAKRTDLTASIQGMRVV
TSRSSLADEIRRQYLIDYGNYWQQFLADIRPATSGENGRDGTLALDQATLRALAAPDSPLVRLARAVVRE
TSLSVINAQDPSSLNDLALTAVGRQSTAARTAAIEAAKIAAQRPETRLEKEFVDNRFAALREVTTGQADT
GSGPAMTDKPISGGGKALQLDAILTLINEQYTRLVVASNALSANSMPPALDIGTTLQTEAEKLPAPLQLV
LGGIATQVADKVGQEVGGLLAMQVDTSVGQSCRRTIDGKYPFVRSSQEVDVEDFNRMFAAGGVFDEFFQK
SLASYVDTNAKPWRYKSLSPGMPPIKGPSLAPFERAAAIREVFFRDQGAKRMAWKMDAKVAAIDPEITEL
LIDIDGQTQRYVHGPVTPFALSWPGPRGGAVAEIAAKPAIRPDTSTIVATGPWALFRLIERGRLTGTASA
SRLTLGFDFDGRHAALELMTSGQSNPLTSNLLTGFHCPGGLA
 
Nucleotide Sequence: 3909 bp     [Download]
>gi|172059067|ref|NC_010551.1|:c3353488-3349580 Burkholderia ambifaria MC40-6 chromosome 1, complete sequence
ATGTCTTATTTGAAACGTCTTTTCAGATGGTTGGTTTCGTGGCGGATGCTGGCGTGCGTGGCGATGCTGC
TGGCGTGCGTGGCGGTCTGGTTCCTGGGACCCCTGTTCGTGTTCGGCGAACTGCATCCGTTCGCCGGCGC
CGTGATCCGTTCGATCGTGATTGCGCTGTTGGTGTGCCTGCTCGTCCTGTGGCTGCGGCGGTGGCCGCTG
AGTCCGATCTGGGTGATCGCGCTTTGCGTCGCGCTTTGGCACGTCGGGCCGTTGTTCGGATTCGCGGAGC
ATCATCCGCTCGAGCCGATCTGGGTACGCGTGCTGATCGTCGCCGCGATCGTGTTCTGCTATGCCGTCTA
CGGGCTCTACAAGTTGTGGCAGGCGCTGCGGTCGAACGATGCGCTGCTGAAGCGCTTTCTCGAGCCGAAG
GGCGATCAGCCGGTCGAAATCGGCCGCGACGAGGTGCGCGCGGTCGCCATGGTGGTGTCCAAGGCGATTG
CGCAGTTGAAGCGCCTGCGTGGCGGCACGCTCGGGTGGCGTCGCTGGCTCGAGGTGGACCGCCATCTGTA
CGGATTGCCGTGGTACATGATGCTGGGGACGCCGGGAGCCGGGAAGACGACCGCGATCCTCGGCGCGGGC
CTGCAGTTTCCGTTGACCGATCAGATGGGCGCGATGTCCGCGCACGATATCGAGCACACCGCGAACTGCG
ATTGGTGGTTCGCGAACGAGGCGGTGCTGATCGACACCGCCGGCCGCTACGTCGAACAGGACGACGCAGC
GGACGAAACGGCCACGACGATCAATGCCGCGGAATGGAAGGAGCTGCTCGGTCAGTTGCGCAAGCATCGA
CCGCGTGCGCCGCTCAACGGCGCGATCCTGACGGTCAGCGTCGCGGATCTGGTCAACCGGTCGGAGGCGG
AGCGCACCGCGCTCGCGGCAAGCCTGCGCGCCCGTCTCGGCGAGCTGCGCCAGCAACTGGGGATTCGTTT
CCCGGTATACGTGTTCGTGACGAAACTGGACCTGCTGCCCGGCTTCACCGAATATTTCCAGTCGCTGACG
GCGGACGGGCGCACGCAGATCTGGGGCTTTACGCTGCCGTGTGACGAGTCGGGCGAGGCCAGTGTCGACG
GGCTGCGACGTCACTGCGTGCACGAGCTGGCGCTGCTCGAAGCGCGGATCGATGCCGGCGTGAACAACCG
CTTGCTGGAAGAATACGAGAGCGATCGTCGCAAGCGGTTGTACCCGCTCGCACAGGAATTCCGCGGTCTG
TCGATGCTGGTTGCGGATTTGGTCGAACTGGTGTTCCTCGATTCCCGCTATGACGACGCGCAGTTGCAGA
ACATGCTGCGCGGCGTGTATTTCACGAGCGCCGAGCAGACGGACCAGATGGTGGCCGTCGATCGCGAGAC
GGTGCTGCAGCGGCTGAAACGCAAGCTCGCGCGCCTTCGTACGGTCAGCGACACGGCAGCGCAAGCGCGC
GGCGACGGGGCGATAGCAGGGCATCGGAGTTTCTTCCTGCGCAATGTGTTTCAGCACGTGATCGTGCCGG
AGGCGCATCTGGTCCGTGCCGACCTGAAGTGGGAGATACGCTTCAGAACGATGCGCTGGGCCGGTCATCT
GCTGACCGCGGCCGTGTTCGTCTGGCTCGCGTTCGCGTTGACGGTGAGTCACGAAAACAACCAGAACTAT
TTGTCGGCGATTGCCGGCAAGACCTCGGCGCTCGCCGTGCACGCCGCGGCGTACAACAAGGCGCCGAAGG
CGTCGGCGATCGGCGGTCTGCTGGACAGATCGAGGGATCTGCCGCGCTACGGCGATCTCGATCTCGACGC
GCCGGGGCTCGCTTACCGTTATGGCCTGTACGTCGTTCCGGCCATCGTCACCGCGTCCGACACGACCTAT
CTGAGCCTGCTGAAGCAGACCTTGATGCCGCAAATCGTGTCGCGCGTCGAAAGCGAGCTGAACACGCAGA
TCGCAGCGCAAAACTCTGACGATGTGTACCGGACGCTGGCCATCTATCTGATGTTGTACGACGCCGAGCG
TTACGACGCGAAGGCCGTGCGAGCATGGGTATTGCGTGACTGGGAGCGCTCGGACAGCGCGGCGGCGATG
GGAGGGCGCAATGCGATGACGCGCCACCTGGAGGCGCTGTTCGTCGACGAACGGCCCGTCACGCCGTCCA
TGAAACAGGATGCCGCGCTCGTGCAGCGGGCGCGACTCTTCCTGAGCCAGAATCCGGCGCCGAAACGCCT
CTATGAACGGGCGATCGGTGCGATGGAGAAAGAGGCACCCGACAACTTCACGCTCGCGCAGGCACTCGGG
TTGCAGGGTGCGTCGCTCTTCAAGCTGGTGGATGGCTCGCGCTTCGAACGAGGCGTGCCGGGGCTTTACA
CGTACGACGGTTACCACGCGCTGTTCAGTCGGCGCCTGCCGGAATTTCTGGCGCGCGCGCAGGCCGACGA
CGATTGGGTCATGGGCCGTCCCGCCAAGCGCACCGACCTGACCGCGTCGATCCAGGGCATGCGTGTCGTG
ACGTCGAGATCGTCGCTTGCCGACGAGATTCGCCGCCAGTATCTGATCGATTACGGGAACTACTGGCAAC
AGTTTCTCGCGGACATTCGGCCGGCCACCAGTGGCGAGAATGGTCGCGACGGCACGCTGGCGCTCGATCA
GGCGACGCTGCGCGCGCTCGCCGCGCCCGATTCGCCGCTGGTCAGGCTGGCGCGTGCGGTGGTCAGGGAA
ACGTCGCTGTCGGTGATCAATGCACAGGACCCATCGTCGCTGAACGATCTCGCGCTGACGGCGGTTGGCC
GCCAATCGACCGCGGCGCGGACCGCGGCGATCGAGGCCGCGAAGATTGCCGCGCAGCGGCCCGAAACGCG
GCTCGAAAAGGAGTTCGTCGACAACCGCTTTGCAGCGCTGCGCGAAGTCACCACCGGACAGGCCGACACC
GGCAGCGGCCCGGCGATGACGGACAAGCCGATCTCCGGGGGCGGCAAGGCGTTGCAACTCGACGCGATTC
TGACGCTGATCAACGAGCAATACACGCGCCTCGTCGTCGCGAGCAACGCACTGTCGGCCAACAGCATGCC
GCCGGCGCTGGATATCGGTACGACGTTGCAGACGGAGGCCGAAAAGCTGCCCGCGCCATTGCAGCTCGTA
CTGGGCGGCATCGCGACGCAGGTGGCCGACAAGGTCGGGCAGGAGGTCGGCGGGCTGCTCGCGATGCAGG
TCGATACGAGCGTCGGGCAAAGTTGCCGGCGCACGATCGACGGGAAATACCCATTCGTGCGTAGCAGTCA
GGAAGTCGATGTGGAGGACTTCAACCGGATGTTCGCGGCGGGTGGCGTATTCGACGAATTCTTCCAGAAA
TCGCTGGCGAGCTATGTCGATACGAACGCAAAGCCTTGGCGCTACAAGTCGCTGAGCCCCGGCATGCCGC
CGATCAAGGGCCCGAGCCTCGCGCCGTTCGAACGCGCGGCCGCGATCCGCGAAGTGTTCTTCCGCGATCA
GGGGGCGAAGCGGATGGCGTGGAAGATGGATGCCAAGGTGGCCGCGATCGATCCCGAGATCACCGAATTG
CTGATCGACATCGACGGTCAGACGCAGCGCTACGTGCACGGCCCTGTCACGCCGTTCGCGCTGAGCTGGC
CCGGGCCGCGCGGCGGTGCGGTGGCCGAGATCGCGGCAAAGCCGGCGATCCGGCCGGATACGTCGACGAT
CGTCGCGACGGGGCCTTGGGCGCTGTTCCGGTTGATCGAGCGCGGCCGGTTGACCGGCACGGCATCGGCC
AGCCGTCTGACCCTCGGTTTCGATTTCGATGGCCGGCATGCGGCGCTCGAATTGATGACGAGCGGCCAGT
CGAATCCGCTGACGAGCAACCTGCTCACGGGCTTTCATTGCCCGGGGGGGCTCGCGTGA
 Primer design