SecReT6
Protein ID: 172062675
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3643
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]588351..588773 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB1Z0I9
KEGG IDbac:BamMC406_3643
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.20E-18, Aligned region: 32..116
Protein Sequence: 140 a.a.     [Download]
>gi|172062675|ref|YP_001810326.1| type VI secretion system lysozyme-like protein [Burkholderia ambifaria MC40-6]
MTAGPSLYDMLLGQIGGEPIGAYDDRTLECLSVQQNVRRILNTRAGALKHLPDYGLPDLTNIYKALPASA
HLLKQQMEATLLKYEPRIRSIDVAIVENRDPGILVSFEMTCHLKNTRLVRFGTYFEPPGRLRIERRLDRT
 
Nucleotide Sequence: 423 bp     [Download]
>gi|172062142|ref|NC_010552.1|:c588773-588351 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGACCGCCGGCCCCTCCCTCTACGACATGCTGCTCGGCCAGATCGGCGGCGAGCCGATCGGCGCCTACG
ACGACCGGACGCTCGAATGCCTGAGCGTGCAGCAGAACGTGCGCCGCATTCTCAATACGCGGGCGGGCGC
GCTCAAGCACCTGCCCGACTACGGGTTGCCCGACCTCACGAACATCTACAAGGCGCTACCCGCGTCGGCG
CATCTGCTCAAGCAGCAGATGGAAGCCACGCTACTGAAGTACGAGCCGCGCATCCGTTCGATCGACGTCG
CGATCGTCGAGAACCGCGATCCCGGCATCCTGGTCAGCTTCGAAATGACCTGCCACCTGAAGAACACGCG
GCTCGTGCGCTTCGGCACCTACTTCGAACCGCCGGGCCGCCTGCGCATCGAACGGCGCCTCGACCGGACG
TGA
 Primer design