SecReT6
Protein ID: 172062676
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3644
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]588770..591478 [-]
Producttype VI secretion ATPase
NoteTssH
UniProt IDB1Z0J0
KEGG IDbac:BamMC406_3644
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.30E-40, Aligned region: 242..261
AAA_2 [PF07724], Evalue: 1.30E-40, Aligned region: 619..783
AAA [PF00004], Evalue: 1.70E-19, Aligned region: 244..357
AAA [PF00004], Evalue: 1.70E-19, Aligned region: 624..751
AAA_5 [PF07728], Evalue: 6.90E-17, Aligned region: 244..277
AAA_5 [PF07728], Evalue: 6.90E-17, Aligned region: 304..374
AAA_5 [PF07728], Evalue: 6.90E-17, Aligned region: 623..744
ClpB_D2-small [PF10431], Evalue: 9.90E-15, Aligned region: 790..862
AAA_16 [PF13191], Evalue: 2.70E-11, Aligned region: 97..121
AAA_16 [PF13191], Evalue: 2.70E-11, Aligned region: 221..260
AAA_16 [PF13191], Evalue: 2.70E-11, Aligned region: 289..322
AAA_16 [PF13191], Evalue: 2.70E-11, Aligned region: 467..488
AAA_16 [PF13191], Evalue: 2.70E-11, Aligned region: 591..667
AAA_16 [PF13191], Evalue: 2.70E-11, Aligned region: 688..718
AAA_16 [PF13191], Evalue: 2.70E-11, Aligned region: 780..822
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 243..329
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 362..403
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 622..643
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 685..717
AAA_19 [PF13245], Evalue: 3.60E-06, Aligned region: 241..265
AAA_19 [PF13245], Evalue: 3.60E-06, Aligned region: 621..645
IstB_IS21 [PF01695], Evalue: 7.10E-06, Aligned region: 227..268
IstB_IS21 [PF01695], Evalue: 7.10E-06, Aligned region: 623..642
AAA_25 [PF13481], Evalue: 6.40E-05, Aligned region: 244..268
AAA_25 [PF13481], Evalue: 6.40E-05, Aligned region: 298..332
AAA_25 [PF13481], Evalue: 6.40E-05, Aligned region: 485..543
AAA_25 [PF13481], Evalue: 6.40E-05, Aligned region: 617..652
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 222..258
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 296..398
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 622..636
Arch_ATPase [PF01637], Evalue: 7.10E-05, Aligned region: 694..705
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 239..262
Zeta_toxin [PF06414], Evalue: 0.00012, Aligned region: 609..663
AAA_17 [PF13207], Evalue: 0.00021, Aligned region: 244..346
AAA_17 [PF13207], Evalue: 0.00021, Aligned region: 623..658
Sigma54_activat [PF00158], Evalue: 0.00027, Aligned region: 228..258
Sigma54_activat [PF00158], Evalue: 0.00027, Aligned region: 622..741
AAA_33 [PF13671], Evalue: 0.00039, Aligned region: 244..261
AAA_33 [PF13671], Evalue: 0.00039, Aligned region: 622..827
AAA_18 [PF13238], Evalue: 0.00068, Aligned region: 244..263
AAA_18 [PF13238], Evalue: 0.00068, Aligned region: 624..653
NACHT [PF05729], Evalue: 0.0011, Aligned region: 244..269
NACHT [PF05729], Evalue: 0.0011, Aligned region: 623..648
AAA_29 [PF13555], Evalue: 0.0026, Aligned region: 238..260
AAA_29 [PF13555], Evalue: 0.0026, Aligned region: 620..646
TIP49 [PF06068], Evalue: 0.0031, Aligned region: 244..263
TIP49 [PF06068], Evalue: 0.0031, Aligned region: 292..324
TIP49 [PF06068], Evalue: 0.0031, Aligned region: 622..658
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 245..265
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 624..645
DUF258 [PF03193], Evalue: 0.006, Aligned region: 234..261
DUF258 [PF03193], Evalue: 0.006, Aligned region: 622..635
AAA_10 [PF12846], Evalue: 0.0088, Aligned region: 243..282
AAA_10 [PF12846], Evalue: 0.0088, Aligned region: 309..332
AAA_10 [PF12846], Evalue: 0.0088, Aligned region: 623..649
Protein Sequence: 902 a.a.     [Download]
>gi|172062676|ref|YP_001810327.1| type VI secretion ATPase [Burkholderia ambifaria MC40-6]
MTPPLRDASHLIRRLNPHCTRALEAAANLCQTRLADEIAVEHWVLKLIEADDGDIPALLRHYDLDIDAVW
DAMIDVIERMPRTLRGMPALSRQLATVLEDAWAHATADDPDDSIRSGHLLQAIVDAPHVLRTQRAWPLLS
VSSAQIRRVLPRLGRRSCENAVDEPVSARKADSARDPHATGTPTSATAAHPAPTRAIEHDALARFTLDIT
EKARRGEIDPVFGRDREIRQMIDVLARRRKNNPILVGEPGVGKTALVEGLALRVIDGGVPETIRGTRILT
LDLGLLQAGAGVKGEFEQRLKNVIDEVRASTTPILLFIDEAHTLIGAGNTAGGADAANLLKPALARGELR
TIAATTWAEYKQYFERDAALERRFQVVKVDEPDDEAACLMLRGLASRYAAHHEVHIRDEAIVAAVRLSRR
YIPARQLPDKAVDLIDTAAARVRMALDVLPAELQQAHAALAALELERAALDADARAGIAGIAERRAAIDT
EHDAMRDTADTLLGQYARERELVDAVRTLRGAADPAPDSAHVIKAIDALANAQGKSPMISPDVDAQSIAR
VVAEWTGVPVGNLVEDELRSLLALESTLATRVVGQDDAIGALAESLRTAKAGLKSEHAPLGVFLLAGPSG
VGKTETALALADALFGGTAALTTINLSEYQEAHTVSQLKGSPPGYVGYGRGGVLTEAVRQRPYSVVLLDE
VEKAHRDVLDIFYQVFDRGTMRDGEGREIDFRNCVIVMTSNLGSAQIDDATAENASITQVALREAIHPQL
VAHFQPALLARFQTLVYRPLDAASLASIMRIKLDKIAERLHRQHAVTLTCDDDLIESIAQHCVSRESGAR
DVDAFLNQRVLPVVSRELLARMATGVTPRHIVLSTGVEGALTIDFVDAPATTDNRIEQPNHR
 
Nucleotide Sequence: 2709 bp     [Download]
>gi|172062142|ref|NC_010552.1|:c591478-588770 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGACGCCGCCGCTCCGGGACGCTTCTCATCTCATTCGCCGCCTCAATCCTCACTGCACGCGCGCACTCG
AAGCCGCGGCGAATCTGTGCCAGACCCGGCTCGCGGACGAAATCGCGGTCGAGCACTGGGTGCTGAAGCT
GATCGAAGCCGACGACGGCGACATTCCCGCGCTGCTGCGCCACTACGACCTCGACATCGACGCCGTGTGG
GATGCGATGATCGACGTGATCGAGCGCATGCCACGCACGTTGCGCGGCATGCCGGCGCTGTCGCGGCAAC
TCGCCACGGTGCTGGAGGATGCGTGGGCGCACGCGACGGCCGACGATCCCGACGACTCGATTCGTTCGGG
GCACCTGCTGCAGGCGATCGTCGACGCCCCTCATGTGCTGCGCACCCAGCGTGCGTGGCCGCTGCTGTCC
GTCTCCAGCGCGCAGATTCGTCGTGTGCTGCCCCGGCTCGGGCGGCGCTCGTGCGAAAACGCGGTTGACG
AACCCGTATCGGCACGCAAAGCGGACTCGGCCCGCGATCCGCACGCAACGGGAACACCGACGTCGGCCAC
CGCGGCACACCCTGCCCCCACGCGCGCGATCGAGCACGACGCACTCGCGCGCTTCACCCTCGACATCACC
GAAAAGGCGCGTCGCGGCGAGATCGACCCCGTCTTCGGACGCGACCGCGAAATCCGGCAGATGATCGACG
TGCTCGCGCGCCGCCGCAAGAACAATCCGATCCTGGTTGGCGAACCGGGCGTCGGCAAGACCGCGCTTGT
CGAAGGGCTCGCCTTGCGCGTGATCGACGGCGGCGTGCCGGAAACGATCCGCGGCACGCGCATCCTGACG
CTCGATCTCGGCTTGCTGCAGGCCGGCGCCGGTGTAAAGGGCGAATTCGAACAACGGCTGAAGAACGTGA
TCGACGAGGTGCGAGCTTCGACGACACCGATCCTGCTGTTCATCGACGAGGCGCACACGTTGATCGGTGC
CGGTAACACGGCAGGCGGCGCCGATGCCGCGAACCTGCTCAAGCCGGCGCTCGCACGCGGGGAGTTGCGC
ACGATCGCGGCCACCACGTGGGCCGAGTACAAGCAATACTTCGAGCGCGACGCGGCGCTCGAACGGCGCT
TCCAGGTCGTCAAGGTCGACGAGCCGGACGACGAAGCAGCGTGCCTGATGCTGCGCGGGCTCGCGAGCCG
CTATGCGGCCCATCACGAGGTTCACATCCGCGACGAGGCGATCGTCGCGGCCGTGCGCCTGTCGCGCCGC
TACATTCCGGCGCGCCAGTTGCCGGACAAGGCCGTGGATCTGATCGATACGGCAGCCGCGCGCGTGCGGA
TGGCACTCGACGTACTGCCGGCGGAACTTCAACAGGCGCATGCCGCGCTGGCGGCGCTCGAGCTGGAACG
CGCGGCGCTCGATGCGGACGCCCGTGCGGGCATCGCCGGCATCGCGGAGCGACGTGCCGCGATCGATACG
GAGCACGACGCGATGCGCGACACCGCCGACACGCTGCTCGGTCAGTACGCACGGGAGCGCGAACTCGTCG
ATGCAGTGCGCACGCTTCGTGGTGCGGCCGACCCCGCGCCTGACTCGGCCCACGTAATCAAGGCGATCGA
CGCGCTGGCGAACGCTCAGGGAAAGTCGCCGATGATCTCCCCCGACGTCGACGCGCAATCGATCGCGCGT
GTCGTCGCCGAATGGACGGGCGTACCGGTCGGCAATCTCGTCGAGGACGAACTGCGGAGCCTGCTCGCGC
TCGAGTCGACGCTCGCGACGCGCGTGGTCGGACAGGACGATGCGATCGGCGCATTGGCTGAGAGCTTGCG
CACCGCCAAGGCCGGCCTGAAAAGCGAGCACGCGCCGCTCGGCGTATTCCTGCTCGCCGGGCCGTCCGGC
GTCGGCAAGACCGAGACGGCGCTCGCGCTCGCCGACGCGCTGTTCGGCGGTACCGCGGCGCTGACGACGA
TCAATCTGTCGGAGTACCAGGAAGCGCACACGGTATCGCAGCTCAAGGGTTCGCCACCCGGCTATGTCGG
TTACGGACGCGGCGGCGTGCTGACCGAAGCCGTGCGTCAGCGTCCGTACAGCGTCGTGCTGCTGGACGAA
GTGGAGAAGGCGCATCGCGACGTGCTCGATATTTTTTATCAGGTGTTCGACCGCGGCACGATGCGCGACG
GTGAAGGGCGCGAGATCGATTTCCGCAACTGCGTGATCGTGATGACGTCCAATCTCGGCAGTGCGCAGAT
AGACGACGCGACGGCCGAGAACGCGTCGATCACGCAGGTCGCGTTGCGCGAAGCCATTCATCCGCAGTTG
GTCGCGCATTTTCAGCCGGCGCTGCTCGCACGCTTCCAGACGCTCGTCTATCGGCCGCTCGATGCCGCGT
CGCTTGCATCGATCATGCGGATCAAACTGGACAAGATTGCCGAACGCCTGCATCGGCAACACGCCGTCAC
GCTCACTTGCGACGACGATCTGATCGAATCGATCGCGCAGCACTGCGTGTCACGGGAATCCGGCGCACGC
GATGTCGATGCATTCCTGAACCAGCGTGTACTGCCCGTCGTGTCCCGTGAGCTGCTTGCCCGGATGGCAA
CGGGTGTCACGCCGCGACACATCGTGCTGTCGACCGGCGTTGAAGGTGCGTTGACGATCGATTTCGTCGA
CGCCCCGGCCACGACCGATAACCGCATCGAGCAACCGAACCACCGATGA
 Primer design