SecReT6
Protein ID: 172062678
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3646
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]592154..593917 [-]
ProductOmpA/MotB domain-containing protein
NoteTagL
UniProt IDB1Z0J2, B1Z0J2
KEGG IDbac:BamMC406_3646
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.40E-18, Aligned region: 470..566
DUF218 [PF02698], Evalue: 0.00022, Aligned region: 140..164
DUF218 [PF02698], Evalue: 0.00022, Aligned region: 479..545
Protein Sequence: 587 a.a.     [Download]
>gi|172062678|ref|YP_001810329.1| OmpA/MotB domain-containing protein [Burkholderia ambifaria MC40-6]
MLPTAATRADSNAARAALSGLGYPLRTVVTLSAALALAVVGWVVPVERGVMWGWVALVVALSALIVWLHS
RGLTRAREQNVQVIAQLGAATANLPVTMRTRMPLALVTGDGLSALFDRDTAMSRFVHVGDGAIWLRADRP
QDLPRLAVAVRQWRDGHAPDCVVLAVAPGLHANDDTLSQSLRVIRQAVADASRMLGTSLPGYVALYQRLS
NANAAATLPAVESAARWYGMSTGSPIVNTHRFDTAIEAAESDALHADGSPAVAARAAGVASMIGWTRRVV
FDTLTDRRQPASPWPLFGVGWIDHGPASGPGKPWEREVRSLTGIAPATLPASPTPWPLPQPLIDAMPRRT
WRSPRITAAAHVIAIVACAAIAAICGAAKNNEALMTRIGEHLQHYNRIPATHDTAKRDALRVLVSDRDQL
DRYARVGVPLRLSFGTYRGAPLLPVINDAIASYEPSPPPPAVVTLDSMSLFDSGKATLRTGTTRAMVDAL
ELIKAHSGKRVLVAGYADDQGRPDRNLKLSIDRASAVRDWLVEASGIPPTRFAIQGYGDTRPVADNATPE
GRAKNRRVEITLVPDTPVPAVPTGAAR
 
Nucleotide Sequence: 1764 bp     [Download]
>gi|172062142|ref|NC_010552.1|:c593917-592154 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGCTCCCCACGGCGGCAACCCGCGCCGATTCCAATGCGGCACGCGCGGCGTTGTCGGGCCTCGGCTATC
CGCTCAGGACGGTCGTGACGCTGTCCGCGGCACTGGCATTGGCCGTCGTCGGATGGGTTGTACCCGTCGA
GCGCGGCGTCATGTGGGGATGGGTAGCGCTCGTCGTCGCGCTTTCCGCGCTGATCGTCTGGTTGCATTCG
CGCGGATTGACGCGCGCCCGCGAACAAAACGTTCAGGTGATTGCGCAACTGGGCGCGGCGACCGCCAACC
TGCCCGTCACGATGCGCACGAGAATGCCGCTCGCGCTCGTCACGGGCGACGGTCTGTCCGCGTTGTTCGA
TCGCGATACGGCCATGTCGCGTTTCGTACATGTCGGCGACGGCGCGATCTGGTTGCGAGCCGACCGCCCT
CAGGATCTTCCCCGGCTCGCCGTTGCGGTCCGCCAGTGGCGGGACGGTCATGCGCCGGATTGTGTCGTGC
TGGCGGTCGCGCCGGGCCTTCATGCGAACGACGACACGCTGTCGCAGTCGCTGCGCGTGATCCGGCAAGC
CGTGGCCGATGCGTCCCGCATGCTCGGCACGTCGCTGCCGGGCTATGTCGCTCTCTATCAGCGGCTCTCG
AACGCAAATGCCGCGGCGACGTTGCCCGCCGTCGAATCGGCGGCCCGGTGGTATGGCATGTCGACCGGAT
CGCCCATCGTCAACACGCATCGCTTCGACACCGCGATCGAAGCAGCCGAGTCGGATGCGCTCCATGCCGA
CGGCAGCCCCGCGGTCGCGGCACGCGCCGCCGGCGTCGCATCGATGATCGGATGGACCCGACGCGTCGTG
TTCGACACGCTGACGGATCGACGCCAGCCCGCATCGCCGTGGCCGTTGTTCGGCGTGGGCTGGATCGACC
ATGGCCCGGCGAGCGGCCCCGGCAAACCGTGGGAACGGGAAGTCCGCAGCCTGACAGGTATCGCCCCGGC
CACACTGCCTGCGTCGCCGACGCCGTGGCCATTGCCGCAACCGCTGATCGACGCGATGCCGCGCCGCACG
TGGCGGTCGCCGCGCATCACCGCCGCCGCGCACGTCATCGCGATCGTCGCCTGCGCCGCAATCGCCGCCA
TCTGCGGCGCCGCAAAGAACAACGAGGCGTTGATGACCCGCATCGGCGAGCACCTCCAACACTACAACCG
AATCCCCGCCACGCACGACACGGCCAAACGCGACGCGCTCCGAGTCCTTGTGTCGGACCGCGATCAGCTC
GACCGGTACGCACGGGTCGGCGTGCCGCTCCGGCTGTCGTTCGGCACCTATCGCGGCGCACCGCTGCTGC
CCGTCATCAACGACGCAATCGCGTCGTACGAACCGTCCCCGCCGCCGCCCGCCGTCGTCACGCTGGACAG
CATGTCGCTGTTCGACAGCGGCAAGGCAACGCTCCGAACGGGCACCACGCGCGCGATGGTCGATGCGCTC
GAACTGATCAAAGCCCATTCGGGCAAACGCGTGCTCGTCGCTGGCTACGCGGACGATCAGGGTCGGCCCG
ATCGCAATCTGAAGCTGTCGATCGATCGCGCGTCAGCCGTGCGCGACTGGCTCGTCGAAGCATCGGGCAT
CCCGCCGACACGGTTCGCGATCCAGGGCTACGGCGATACGCGGCCGGTCGCGGACAACGCCACGCCGGAA
GGGCGGGCGAAGAATCGTCGGGTCGAGATCACGCTCGTGCCCGATACACCGGTGCCTGCCGTCCCGACCG
GCGCCGCGAGGTAA
 Primer design