SecReT6
Protein ID: 172062679
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3647
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]593929..594603 [-]
Producthypothetical protein
NoteTssL
UniProt IDB1Z0J3
KEGG IDbac:BamMC406_3647
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.40E-43, Aligned region: 2..208
Protein Sequence: 224 a.a.     [Download]
>gi|172062679|ref|YP_001810330.1| hypothetical protein BamMC406_3647 [Burkholderia ambifaria MC40-6]
MRALLRDTALLVSQLSNGGEVDNAATLREQCRLLVAQFATALDAQGIAADVRDDAIVAQCGLIDEAALRH
LPASAKAKWESTPLQVERFGTHDTGTRLYERLDYRMREPVPNVDLLECYAAVLGLGFRGRYAARSGPSAG
AHDGEAKRQALIAALVAQIDQLRPAVRPGLVADRSNTRLLDRLRHVSPWMITGAACVIAILVWFAWDRIL
DAELAQLIQQAKRP
 
Nucleotide Sequence: 675 bp     [Download]
>gi|172062142|ref|NC_010552.1|:c594603-593929 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGCGTGCGCTGTTGCGCGATACCGCATTGCTCGTCAGTCAACTGTCAAACGGCGGCGAGGTCGACAACG
CCGCAACCCTGCGTGAGCAGTGTCGCCTGCTGGTCGCGCAGTTCGCGACCGCGCTCGATGCGCAAGGCAT
TGCCGCGGACGTACGGGACGACGCGATCGTCGCCCAGTGTGGGCTGATCGACGAAGCCGCACTGCGACAC
CTGCCGGCTTCCGCCAAGGCGAAGTGGGAATCCACGCCGCTACAGGTCGAGCGATTCGGCACGCACGATA
CAGGCACGCGCCTCTACGAGCGGCTCGACTACCGGATGCGCGAGCCCGTGCCGAACGTCGACCTGCTCGA
ATGCTATGCGGCCGTTCTCGGCCTGGGATTCCGTGGCCGGTATGCCGCCCGCTCGGGGCCGTCCGCGGGC
GCCCATGACGGTGAGGCGAAACGTCAGGCACTGATTGCCGCGCTGGTTGCGCAGATCGATCAATTGCGGC
CGGCGGTCCGCCCGGGGTTGGTCGCCGATCGCTCCAACACACGACTGCTCGACCGGCTCAGGCATGTGTC
GCCATGGATGATCACGGGCGCGGCATGCGTCATCGCGATACTCGTCTGGTTCGCGTGGGATCGGATCCTC
GATGCCGAACTGGCCCAACTCATCCAGCAAGCGAAACGGCCATGA
 Primer design