SecReT6
Protein ID: 172062680
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3648
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]594684..596033 [-]
Producttype VI secretion protein
NoteTssK
UniProt IDB1Z0J4
KEGG IDbac:BamMC406_3648
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.10E-124, Aligned region: 18..447
Protein Sequence: 449 a.a.     [Download]
>gi|172062680|ref|YP_001810331.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MRIDKPLWHEGLILTQQHFQQQERWNGFALQQLASAVAVSPWGTLNVDIDEEALSSGRLKLARLQLRFPD
GTPIDTTVSDALPPARDLVSEIPADTQTVDVLAALALPDANGSNCRFDETALARPRRAYREFVKVTDLNG
SAETEIAAERHAVRLLFGFESHADDTACAIARLTRTTSGQFQVDRRYVPPCLALSGHTLHIERIRRIADI
LAAKSALLGARRSERIEQVAEYGVADVQLFWLLHCIHQAWPQLRFLASHPAQPTDRLYQVLAQLTGSLIT
FSTRVSLTDIPPYDHASAHDVFAALESLIRDLLDAIIPSRVVSIGLSHTTLTTWVGQFRDERIVEDAADW
YLSVNAALPAFELVEQFPRLCKIGAPDDVEHIVNSAVAGIPLKAVQRVPGAIPVRLDNHYFALDAHDAAH
ARMLAARACQIYLPASIPDASLELYAVLR
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|172062142|ref|NC_010552.1|:c596033-594684 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGCGGATCGACAAACCGCTCTGGCATGAAGGGCTGATTCTTACGCAGCAGCATTTCCAGCAGCAGGAGC
GCTGGAACGGGTTCGCGCTGCAACAACTGGCGTCGGCTGTCGCCGTATCGCCATGGGGAACGCTGAACGT
CGACATCGACGAGGAGGCGCTGTCCTCCGGCCGCCTGAAGCTCGCGCGGCTGCAACTGCGATTCCCTGAC
GGCACGCCGATCGACACGACCGTCTCCGACGCGTTGCCGCCGGCCCGCGACCTCGTCAGCGAAATCCCCG
CCGATACGCAGACCGTCGACGTACTCGCCGCGCTCGCGCTACCCGACGCGAACGGCAGCAACTGCCGTTT
CGACGAAACGGCGCTGGCCCGCCCGCGTCGCGCGTATCGCGAGTTCGTCAAGGTGACGGACCTGAACGGC
TCGGCCGAAACCGAAATTGCCGCCGAGCGTCACGCCGTCCGGTTGCTGTTCGGCTTTGAATCGCACGCCG
ACGACACGGCATGCGCGATCGCACGCCTGACGCGCACGACGAGCGGGCAGTTCCAGGTCGATCGCCGATA
CGTGCCGCCTTGTCTTGCGCTATCCGGTCACACGCTGCATATCGAACGTATTCGGCGAATCGCCGACATC
CTCGCCGCCAAAAGCGCGCTCCTCGGTGCGCGCCGCAGCGAGCGCATCGAGCAGGTGGCCGAGTATGGCG
TCGCCGATGTCCAGCTGTTCTGGCTCCTGCATTGCATTCACCAGGCGTGGCCGCAACTGCGCTTCCTCGC
GTCGCACCCGGCGCAGCCGACCGATCGCCTGTACCAGGTGCTCGCCCAGCTGACCGGGTCGCTGATCACG
TTCTCGACGCGCGTGTCGCTGACCGACATTCCGCCCTACGACCACGCGAGCGCCCATGACGTATTCGCAG
CGCTCGAATCGCTGATCCGCGATCTGCTCGACGCGATCATTCCGTCACGCGTCGTCTCGATCGGGCTCTC
GCATACGACGCTGACGACCTGGGTCGGTCAGTTCCGCGACGAGCGCATCGTCGAAGATGCCGCGGACTGG
TATCTGTCCGTCAATGCCGCGTTGCCGGCCTTCGAGCTGGTCGAACAGTTTCCGCGCCTTTGCAAGATCG
GCGCACCGGACGACGTCGAGCACATCGTCAATTCCGCCGTGGCGGGAATTCCGCTCAAAGCCGTGCAGCG
GGTGCCCGGCGCCATACCGGTCCGGCTGGACAACCACTATTTCGCGCTCGATGCGCACGACGCCGCGCAT
GCGCGGATGCTCGCCGCGCGCGCTTGCCAGATCTATCTGCCCGCGTCGATTCCGGACGCGTCGCTCGAAC
TTTATGCGGTGCTGCGCTGA
 Primer design