SecReT6
Protein ID: 172062681
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3649
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]596614..597126 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB1Z0J5
KEGG IDbac:BamMC406_3649
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 9.40E-54, Aligned region: 5..157
Protein Sequence: 170 a.a.     [Download]
>gi|172062681|ref|YP_001810332.1| type VI secretion protein [Burkholderia ambifaria MC40-6]
MDSFQREIPKSRVSITLDLHTGGAQKKVELPLKLLVAGDFSAGREQAPLAERKKVNIDKNNFDAVLADYA
PDLRIAADNTLAGDGSELPVNLSFRSIKDFAPEQVARQIPELQALLAMRNLLRDLKSNLLDNGTFRREFE
KVLKDDRLSAKLRGELAQIATAATQPEGHA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|172062142|ref|NC_010552.1|:596614-597126 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
TTGGATAGCTTTCAGCGAGAGATCCCGAAGAGCCGGGTGTCGATCACGCTCGACCTGCATACGGGTGGAG
CGCAGAAGAAGGTCGAGTTGCCCTTGAAGCTGCTGGTCGCCGGCGACTTCAGTGCCGGCCGTGAGCAGGC
GCCGCTTGCCGAGCGCAAGAAGGTCAACATCGACAAGAACAACTTCGACGCCGTGCTGGCCGACTATGCG
CCGGATCTCAGGATCGCCGCGGACAACACGCTGGCCGGCGACGGTTCGGAGCTGCCCGTCAACCTGTCGT
TCCGCTCGATCAAGGATTTCGCGCCCGAGCAGGTCGCGCGCCAGATTCCCGAGCTGCAGGCGCTCCTCGC
GATGCGCAACCTGCTGCGCGACCTGAAATCGAACCTGCTCGACAACGGCACGTTCCGTCGCGAGTTCGAG
AAGGTGCTGAAGGACGATCGCCTGTCCGCGAAGCTGCGCGGCGAACTCGCGCAGATCGCGACCGCCGCGA
CGCAGCCGGAAGGGCATGCGTGA
 Primer design