SecReT6
Protein ID: 172062682
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3650
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]597200..598750 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB1Z0J6
KEGG IDbac:BamMC406_3650
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.70E-178, Aligned region: 93..512
Protein Sequence: 516 a.a.     [Download]
>gi|172062682|ref|YP_001810333.1| EvpB family type VI secretion protein [Burkholderia ambifaria MC40-6]
MKYTETQHAGASETVVLDAPHGDIDSVYASLCSKINLKPVSEARPLEAFRDNDMLSEASADERIARGMGA
FLELVANARQPVDRLDKSLLDFHIGQIDRQISRQLDAVMHTPEFQALEARWRGLKMLVSRTDFRKNARIE
VLDVSKDALQRDFEDTPELIQSGLYRLTYIEEYDTPGGQPISAMISDFEFANSPMDVALLRNISKVAAAA
HMPFIGSVGPAFFGKQSMEEVAAIQDIGNYFDRAEYIKWKSFRDTDDARYVGLTMPRVLGRLPYGKDTAP
VRAFNYEEAVKGPDHDKYLWMNASFAFAANMVRSFVSNGWCVQIRGPQAGGKVEDLPVHLYDLGTGHQPK
IPTEVLIPETREFEFANLGFIPLSFYKNHDFACFFSANSAQKPALYETREATANSRINARLPYIFLLSRI
AHYLKLIQRENIGTTKDRRLLELELNNWIKGLVTEMKDPGDELQASHPLREAKVTVEDIEDNPGFFRIKL
FIVPHFQVEGMDIGLSLVSQMPKSKN
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|172062142|ref|NC_010552.1|:597200-598750 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGAAATACACTGAAACGCAGCACGCCGGCGCGAGCGAGACCGTCGTGCTGGACGCCCCGCACGGGGATA
TCGACAGCGTCTATGCGTCGCTGTGCAGCAAGATCAACCTGAAGCCCGTCAGCGAAGCGCGCCCGCTCGA
GGCGTTCCGCGACAACGACATGCTGTCCGAGGCGTCGGCCGACGAGCGCATCGCGCGCGGGATGGGCGCA
TTCCTCGAACTCGTCGCGAACGCGCGCCAGCCGGTGGACCGCCTCGACAAGTCGCTGCTCGATTTCCATA
TCGGCCAGATCGACCGGCAGATCAGCCGTCAACTCGACGCCGTGATGCATACGCCGGAATTCCAGGCGCT
CGAGGCACGCTGGCGCGGCCTGAAGATGCTCGTAAGCCGCACCGATTTCCGCAAGAACGCACGCATCGAA
GTGCTTGACGTGTCGAAGGACGCGCTGCAGCGCGACTTCGAGGATACGCCGGAACTGATCCAGAGCGGCC
TGTACCGCCTGACGTACATCGAGGAATACGACACGCCGGGCGGTCAGCCGATCAGCGCGATGATCAGCGA
CTTCGAGTTCGCGAATTCGCCGATGGACGTCGCACTGCTGCGCAACATCTCGAAGGTGGCGGCCGCCGCG
CACATGCCGTTCATCGGCTCGGTCGGGCCGGCGTTCTTCGGCAAGCAGTCGATGGAGGAAGTTGCCGCGA
TCCAGGATATCGGCAACTACTTCGATCGCGCCGAGTACATCAAGTGGAAGAGCTTCCGCGATACCGACGA
TGCGCGTTACGTCGGCCTGACGATGCCGCGCGTGCTCGGCCGCTTGCCGTACGGCAAGGACACGGCGCCG
GTGCGCGCGTTCAACTACGAGGAGGCCGTCAAGGGCCCCGACCACGACAAGTACCTGTGGATGAATGCGT
CGTTCGCGTTCGCGGCGAACATGGTGCGCAGCTTCGTGAGCAACGGCTGGTGCGTGCAGATTCGCGGACC
GCAGGCGGGCGGCAAGGTCGAGGACCTGCCGGTTCACCTGTACGACCTCGGCACCGGCCACCAGCCGAAG
ATCCCGACCGAGGTGCTGATCCCCGAAACGCGCGAATTCGAGTTCGCGAATCTCGGCTTCATTCCGCTGT
CGTTCTACAAGAACCACGACTTCGCGTGCTTCTTCTCCGCGAACTCGGCGCAGAAGCCGGCGCTGTACGA
GACCCGGGAAGCGACCGCGAACAGCCGCATCAACGCACGGCTGCCGTACATCTTCCTGCTGTCGCGCATC
GCGCACTACCTCAAGCTGATCCAGCGGGAGAACATCGGCACGACCAAGGATCGTCGTCTGCTCGAGCTCG
AGTTGAACAACTGGATCAAGGGGCTCGTGACCGAGATGAAGGATCCGGGTGACGAACTGCAGGCGTCGCA
TCCGTTGCGCGAGGCGAAGGTCACGGTCGAGGACATCGAGGACAATCCGGGCTTCTTCCGGATCAAGCTG
TTCATCGTCCCGCACTTCCAGGTCGAAGGCATGGACATCGGGCTGTCGCTCGTGTCGCAGATGCCGAAGT
CCAAGAACTGA
 Primer design