SecReT6
Protein ID: 172062683
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3651
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]598829..601168 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDB1Z0J7
KEGG IDbac:BamMC406_3651
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.30E-53, Aligned region: 30..349
DUF2345 [PF10106], Evalue: 6.10E-38, Aligned region: 604..743
T6SS_Vgr [PF13296], Evalue: 2.30E-30, Aligned region: 335..350
T6SS_Vgr [PF13296], Evalue: 2.30E-30, Aligned region: 480..585
Phage_base_V [PF04717], Evalue: 4.70E-13, Aligned region: 106..159
Phage_base_V [PF04717], Evalue: 4.70E-13, Aligned region: 415..475
Sarcoglycan_1 [PF04790], Evalue: 0.007, Aligned region: 530..675
Sarcoglycan_1 [PF04790], Evalue: 0.007, Aligned region: 675..716
Protein Sequence: 779 a.a.     [Download]
>gi|172062683|ref|YP_001810334.1| Rhs element Vgr protein [Burkholderia ambifaria MC40-6]
MSMILPSQAYELKLAPHPAPTSVLRFTGRDAVSELYRYDIEFTSPAVGIPMDQVVGRPAKFIVAPVDPNM
DYLRRMFGENTEQFSKMPPTYTIHGVITEFDELDTSADQTHYRVRLEPELADLNRGVTSRLFQKQSIEEI
VTDTLRHYGYRAGVDFQFQLRGQYKRREYVTQYHETTFSFIQRICAEEGLWFRWEQRKDYAVLVFGDDLD
AYARKQRTVSHRRDSGLESSGMDAIKTLEKRTRRVPEAVRLHDYNHREAGVSLLVEENAARDDKTTSGID
YQWGEHYETPEEGKSVARRRHEEYLTNQITFRGTGNPFWLEAGEVMRLAPHPVDAKHGIFVTAVESQGGR
DQSYWVTFEGIPSDRVWRTPVASIEQPVIDGILPARITSPGDYKYAYLTEQGWYVIKLPFDLDEWSPGGT
SRPVRFAKPYSGDNYGHHFPLIDGAEVAVVFTQGNPDRPVIIGAMHDSLHPDLVTSQNHTRNLIRTAAQN
ELRMEDKEGVEHVHLTTPFEASELNLGHMVDGDRKDRGRGVELRTDGPAAVRGSKGVLVTAEGQPGAAGQ
QLDMQDADTTLEQAEQILNALNDSANAAKALQADIDQQRVLIHQKLKQLQKPVIVATAPDGVGIVSGQQM
QLAARKQMFVTAGDGLDIGVMKRIAVAAGEAISLFAAKLGIRIFATKGKVQVQAQSDAMELMSMQDMAVS
SSDGEVIITGRKGVTLGDGSGAYIKLSGGKIILGSPAGEIEAKGNLTIDDPDGGSFKFPTWAAAPVSDVQ
TATNFGFSE
 
Nucleotide Sequence: 2340 bp     [Download]
>gi|172062142|ref|NC_010552.1|:598829-601168 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGTCGATGATTCTGCCTTCGCAGGCTTATGAATTGAAGCTGGCGCCGCATCCGGCGCCGACGTCCGTGC
TCCGCTTCACGGGCCGGGACGCCGTGAGCGAGTTGTACCGCTACGACATCGAATTCACGAGCCCGGCGGT
CGGTATTCCAATGGATCAGGTGGTCGGTCGCCCGGCAAAATTCATCGTCGCGCCGGTCGATCCGAATATG
GACTATCTGCGCAGAATGTTCGGCGAGAACACGGAGCAATTCAGCAAGATGCCGCCGACCTATACGATCC
ACGGCGTCATCACGGAGTTCGACGAGCTCGACACCTCGGCCGATCAGACACACTATCGGGTCCGGCTGGA
GCCCGAGCTCGCTGATTTGAACAGGGGCGTGACGAGCCGGTTGTTCCAGAAGCAGTCGATCGAGGAGATC
GTGACCGACACGCTGCGCCATTATGGCTACCGGGCCGGGGTCGATTTCCAGTTCCAGTTGCGCGGTCAGT
ACAAGCGCCGCGAGTACGTGACCCAGTATCACGAAACGACGTTTTCCTTTATTCAGCGAATCTGCGCCGA
GGAAGGGCTCTGGTTTCGCTGGGAGCAGCGGAAGGATTATGCGGTGCTCGTGTTTGGCGACGATCTGGAC
GCCTATGCGCGCAAGCAGCGCACCGTGTCGCACCGGCGCGACTCGGGGCTCGAGAGTTCGGGCATGGACG
CGATCAAGACGCTCGAGAAGCGGACTCGGCGCGTGCCGGAAGCCGTACGGTTGCACGATTACAACCACCG
TGAGGCGGGTGTGTCGCTGCTAGTCGAGGAAAATGCCGCACGCGACGACAAGACGACGAGCGGCATCGAT
TACCAGTGGGGCGAGCACTACGAGACGCCGGAAGAGGGCAAGAGCGTCGCCCGTCGGCGCCACGAGGAAT
ACCTGACCAACCAGATCACCTTCAGAGGTACCGGAAATCCGTTCTGGCTCGAGGCGGGTGAAGTCATGCG
GCTGGCGCCGCATCCGGTCGATGCGAAGCACGGGATTTTCGTCACGGCGGTGGAGTCGCAAGGCGGGCGC
GACCAATCGTACTGGGTGACCTTCGAGGGGATTCCGTCAGACCGCGTATGGCGCACGCCGGTTGCGTCGA
TCGAGCAACCGGTCATCGACGGTATCCTGCCGGCCCGGATTACGTCACCTGGCGATTACAAATACGCGTA
CCTGACCGAGCAGGGCTGGTATGTGATCAAGCTGCCGTTCGATCTCGATGAGTGGAGCCCGGGCGGCACC
AGCCGGCCGGTACGGTTCGCGAAACCGTATAGCGGCGACAACTATGGGCATCACTTCCCGCTGATTGACG
GTGCGGAGGTGGCGGTTGTCTTCACGCAGGGGAATCCTGACCGACCCGTGATCATCGGGGCCATGCACGA
CAGCCTGCATCCCGATCTCGTCACCAGTCAGAACCATACCCGGAATCTGATCCGCACCGCCGCGCAGAAT
GAACTGCGGATGGAGGACAAGGAAGGTGTCGAGCACGTCCATCTGACGACGCCGTTTGAGGCGAGTGAGC
TGAACCTCGGTCACATGGTCGACGGAGATCGCAAGGATCGCGGGCGGGGTGTCGAGTTGCGCACCGACGG
GCCAGCGGCAGTTCGGGGATCGAAGGGTGTGTTGGTGACTGCGGAGGGACAGCCCGGCGCCGCGGGACAG
CAGCTCGACATGCAGGACGCCGACACGACGCTCGAGCAGGCCGAACAAATCCTGAATGCGCTGAACGACT
CGGCGAACGCGGCGAAAGCGCTGCAGGCTGACATCGATCAACAGCGCGTACTGATCCATCAAAAGCTCAA
GCAGCTTCAGAAACCCGTCATTGTTGCGACAGCTCCCGATGGCGTCGGGATTGTCAGTGGTCAGCAGATG
CAGCTTGCCGCCCGTAAGCAAATGTTCGTGACCGCCGGCGACGGGCTCGACATCGGCGTCATGAAGCGTA
TCGCGGTAGCGGCCGGCGAGGCGATCTCGCTTTTTGCGGCAAAGCTCGGGATTCGAATCTTTGCCACGAA
GGGCAAGGTCCAGGTACAGGCACAGTCCGACGCGATGGAACTGATGTCGATGCAGGACATGGCAGTCAGT
TCGTCGGATGGCGAAGTAATCATCACCGGCCGCAAAGGTGTCACGCTCGGCGATGGATCGGGCGCTTATA
TCAAGTTGTCGGGCGGCAAGATCATCCTCGGGAGTCCGGCCGGAGAAATCGAGGCCAAGGGAAATCTGAC
GATCGACGACCCTGACGGCGGTAGTTTCAAATTTCCGACTTGGGCCGCGGCGCCCGTCAGCGACGTGCAG
ACTGCAACGAACTTCGGATTTTCGGAATAA
 Primer design