SecReT6
Protein ID: 172062687
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3655
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]607138..610956 [+]
Producthypothetical protein
NoteTssM
UniProt IDB1Z0K1
KEGG IDbac:BamMC406_3655
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.30E-76, Aligned region: 425..759
DUF1215 [PF06744], Evalue: 4.30E-34, Aligned region: 259..277
DUF1215 [PF06744], Evalue: 4.30E-34, Aligned region: 895..1012
Sensor [PF13796], Evalue: 0.00037, Aligned region: 19..28
Sensor [PF13796], Evalue: 0.00037, Aligned region: 54..124
Sensor [PF13796], Evalue: 0.00037, Aligned region: 299..327
Sensor [PF13796], Evalue: 0.00037, Aligned region: 369..399
Sensor [PF13796], Evalue: 0.00037, Aligned region: 518..559
Protein Sequence: 1272 a.a.     [Download]
>gi|172062687|ref|YP_001810338.1| hypothetical protein BamMC406_3655 [Burkholderia ambifaria MC40-6]
MNYDKNDNKTRPAGLFIGIAAVIVFLALGIAVWVEGPRYGWSRDTRIIVELSLCVAMLVVVLLVKYLEGV
LLWIASLRASRWFARYDAARHAASVDHDDQDPLPEQTDRAAALRNALQDRHGRRWRYRERWVLIAGDEPL
VKRLAPGLVDTGFAITGDTVLLYAKQTSSMLDADWLAQIRRLRRRRPVDAIVAITRNRGSSNAPFDTDNL
SQRLARHARALRWAAPVYLLNVTDFGRDTSSPDEAIGFTWSNARVSREAIDASLQNLTDYLADSGVVRVT
KDAGDRYPAELSQHISNFHNVLSGLVLHTSRSRTWRQAVHGLLFAPLFTERELAPQVPADANDGGQPADP
SHRTIWQTIAEHSRKIHGRRIGFSLSTTAAWMMTALISCWLVGTLLSGFANRATIGTAANTVANLAGALN
PTQSLQTLTDLDRQIDTLEIHQRDGAPLTARFALNRDHALLDALWPYYADAANRILVRPIRQKLEARLHQ
LASLSDAEIASGGDAQVQAAYDTLKTYMMLAKTERAAAAFLIPQLVAAAAPERPADSPLSKGTWEDLRQQ
AIAFFAKHVGRGAASTYTALAIVPDGSLIASTRQTIIGVRGIQNSGDAIYQQIIDEATPKYPPLSLATLL
GDTASQSSSGGATSRGLFGTTATIPGVFTRAAWEERISKAIDEAGEQRDVASDWVLSDTKVAHSSPSTLK
TELRQRYFDDYARAWALFLNSLRWQPAPTLSATADQLTLLGDPQRSPLVALMNAIVYQAGTGANAQSLSD
TLISKAQQLVGADEKDPSKQAKPQLAPLAAAFGPILRLTGSDLVSGMPTNGKVATTQMAATGDLSLARYL
ERITAMRLKTSQIVSSPDPDAIARLAAQAVLQGKTSDIADSRDYASRVAASLGEQWSGFGALFRAPFDQS
WQVIVQPAASSLNEMWRTAIVADWNKTFGGRYPFADSDNDASLPEMARFMRPDSGVIAQFVTSQLAGVVE
RQGDRWVAAQGADSGALTIDPAFLTGLNKLTRTSTVLFPSGDARVRYELRAEPTPGVTNMRFVLSGRELH
YFNQKQEWTPFEWPGQSLENLSHIEWQTEQGGLRTALDSQGRFGLVRLLERAKVTQQDNARYLLTWTPDT
SQGIPLKVQLRSEAGGGPLDVLQLRNFTLPIRVFVTGSRSAGPRVSTIGPPPLPASAIAAAKHAAVPLPP
GLPGGSPLPDDTIWASAEQASGQRTALGLARAKARTAEPGAAKQTNTPKAAISPLATTSGRSDSFPRPFG
HALRLPSDVFVF
 
Nucleotide Sequence: 3819 bp     [Download]
>gi|172062142|ref|NC_010552.1|:607138-610956 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGAACTACGACAAGAACGACAACAAGACACGACCGGCAGGCCTCTTCATTGGTATTGCTGCCGTCATCG
TGTTCCTCGCGCTCGGTATTGCGGTATGGGTGGAGGGCCCTCGTTACGGGTGGTCTCGCGACACCCGGAT
CATCGTCGAGCTTTCGCTGTGTGTGGCCATGCTGGTGGTGGTCCTGCTGGTCAAGTACTTAGAAGGGGTA
CTGCTGTGGATCGCGTCGTTGAGAGCTTCCCGTTGGTTTGCCCGATACGACGCCGCCCGGCACGCAGCGT
CTGTAGACCACGACGATCAAGACCCACTACCGGAACAAACCGACCGTGCTGCTGCGCTCCGCAATGCTCT
ACAGGATCGCCACGGCCGGCGCTGGCGCTATCGCGAACGATGGGTGCTGATCGCCGGCGATGAACCGCTC
GTGAAGCGTCTGGCGCCGGGTCTGGTCGACACCGGCTTTGCGATCACCGGCGATACGGTCCTGCTGTACG
CGAAGCAAACGAGCAGTATGCTCGATGCCGACTGGCTCGCCCAGATTCGCCGCTTGCGCCGTCGTCGTCC
GGTCGACGCGATTGTCGCGATAACGCGTAACCGCGGTTCGTCCAATGCGCCGTTCGACACCGACAATCTG
TCGCAGCGGCTCGCGCGCCACGCGCGCGCGTTGCGCTGGGCCGCGCCGGTCTATCTGCTCAATGTGACGG
ATTTCGGCCGTGACACGTCGAGTCCCGATGAGGCGATCGGTTTCACCTGGTCCAACGCGCGCGTCAGCAG
GGAAGCAATCGACGCGTCGTTGCAGAACCTCACCGACTACCTGGCCGATTCCGGTGTCGTGCGCGTGACG
AAGGATGCAGGCGACCGTTATCCGGCGGAGCTGTCCCAACACATTTCGAACTTTCACAACGTGTTGTCGG
GTCTGGTGCTGCATACCTCGCGGTCGCGTACATGGCGGCAGGCAGTCCACGGCCTCCTGTTCGCGCCGCT
GTTCACGGAACGGGAACTGGCACCGCAAGTACCCGCGGACGCGAATGATGGCGGGCAACCGGCCGACCCG
TCACACCGCACGATCTGGCAAACCATCGCCGAGCACAGCCGAAAGATTCACGGCCGCCGCATTGGCTTTT
CGCTGTCGACCACGGCGGCGTGGATGATGACGGCCCTGATTAGCTGCTGGTTGGTTGGCACGCTGCTGTC
CGGCTTCGCGAACCGCGCAACGATCGGAACCGCCGCGAATACGGTTGCGAATCTCGCCGGAGCCCTGAAC
CCGACGCAATCGCTGCAAACGTTGACCGACCTCGACCGGCAAATCGACACGCTCGAAATCCATCAGCGTG
ACGGTGCGCCTTTGACCGCTCGTTTCGCGTTGAACCGCGACCACGCACTGCTCGACGCCCTTTGGCCTTA
CTACGCCGATGCCGCGAACCGGATTCTCGTCCGCCCGATCCGCCAGAAGCTCGAAGCGAGGCTGCATCAG
CTCGCGTCCCTGTCCGACGCCGAAATCGCCAGCGGCGGCGACGCCCAGGTCCAAGCCGCGTACGATACGC
TCAAGACCTACATGATGCTCGCCAAAACCGAGCGGGCGGCAGCCGCATTCCTGATACCGCAGCTCGTCGC
CGCTGCCGCGCCTGAACGCCCGGCCGATTCGCCGCTGTCGAAGGGCACGTGGGAAGACCTGCGTCAGCAA
GCGATCGCATTCTTCGCGAAACACGTTGGGCGTGGTGCTGCGTCCACTTACACCGCATTGGCGATTGTCC
CCGACGGAAGCCTGATCGCATCTACCCGTCAGACGATCATCGGCGTGCGCGGCATCCAGAACTCCGGCGA
CGCGATCTACCAGCAGATCATCGACGAAGCGACGCCGAAATATCCGCCGCTGTCGCTCGCGACGTTGCTC
GGTGACACAGCGTCGCAATCCTCTTCCGGCGGTGCGACGAGCCGCGGCCTGTTCGGCACGACCGCCACCA
TACCGGGCGTATTCACGCGTGCCGCGTGGGAAGAGCGAATCTCGAAGGCAATCGACGAAGCCGGCGAGCA
ACGCGATGTGGCGAGCGACTGGGTACTCTCCGACACCAAGGTTGCCCATTCATCTCCGTCGACATTGAAG
ACCGAACTGCGTCAGCGCTATTTCGACGATTACGCGCGGGCATGGGCGCTATTCCTCAACAGTCTGCGTT
GGCAACCCGCACCAACGCTATCAGCCACGGCCGACCAACTCACGCTACTGGGCGACCCGCAACGCTCGCC
GCTCGTCGCGTTGATGAATGCGATCGTGTATCAGGCGGGAACGGGAGCCAATGCTCAGTCGCTGTCCGAC
ACGCTGATCAGCAAGGCACAGCAACTGGTCGGCGCGGACGAGAAGGATCCGTCCAAGCAGGCCAAACCGC
AGCTCGCACCGCTGGCCGCCGCGTTCGGCCCGATCCTGCGCCTGACCGGCAGCGACCTCGTGTCGGGAAT
GCCGACGAACGGCAAGGTAGCCACCACGCAAATGGCAGCGACCGGCGACCTGAGCCTGGCCCGCTATCTG
GAGCGGATCACGGCGATGCGCCTGAAGACATCGCAGATCGTCTCCAGCCCGGATCCGGACGCGATCGCAC
GTCTGGCCGCGCAAGCCGTGCTGCAAGGCAAGACGTCCGATATCGCCGACAGCCGCGATTACGCGAGTCG
TGTCGCTGCGAGCCTCGGTGAACAGTGGTCCGGGTTTGGCGCATTGTTCCGCGCGCCGTTCGATCAGTCG
TGGCAGGTCATCGTGCAGCCGGCCGCATCGAGCCTGAACGAGATGTGGCGCACCGCGATCGTGGCCGACT
GGAACAAGACCTTCGGCGGCCGCTATCCGTTCGCGGATTCGGACAACGACGCATCGCTGCCCGAGATGGC
GCGCTTCATGCGTCCGGACAGCGGCGTGATCGCGCAGTTCGTGACGTCGCAACTGGCCGGTGTCGTCGAA
CGGCAGGGGGACCGGTGGGTCGCCGCACAGGGAGCTGATTCCGGCGCATTGACGATCGATCCGGCTTTCC
TCACTGGTCTGAACAAGCTCACGCGCACGTCGACGGTCCTGTTTCCGTCGGGCGACGCGCGCGTGCGCTA
TGAACTACGCGCCGAGCCGACGCCGGGCGTCACCAACATGAGATTCGTGCTGTCCGGCCGCGAACTGCAT
TACTTCAACCAGAAGCAGGAGTGGACACCATTCGAATGGCCGGGACAGTCGCTCGAGAACCTGTCGCATA
TCGAATGGCAAACGGAGCAGGGCGGCTTGCGTACGGCGCTCGATTCGCAGGGGCGTTTCGGCCTCGTTCG
ATTGCTGGAGCGCGCGAAGGTCACACAGCAGGACAACGCCCGCTATCTGCTGACCTGGACGCCCGACACG
AGCCAGGGCATTCCGCTCAAGGTGCAATTGCGCAGCGAAGCCGGCGGCGGTCCGCTCGACGTTCTCCAGT
TGCGGAATTTCACGTTGCCGATCCGCGTTTTCGTGACGGGATCTCGGAGCGCAGGGCCTCGGGTGTCGAC
GATCGGCCCGCCGCCGTTGCCGGCGTCGGCGATCGCGGCCGCGAAGCATGCGGCTGTGCCGTTGCCGCCG
GGGCTTCCAGGCGGGAGTCCCTTGCCGGACGACACCATTTGGGCGTCGGCGGAGCAGGCCTCCGGTCAAC
GCACCGCGCTCGGCCTTGCTCGAGCAAAAGCGCGAACTGCCGAGCCTGGCGCGGCGAAACAGACGAACAC
GCCCAAGGCCGCGATTTCGCCATTGGCGACCACGTCGGGGCGCTCCGATTCCTTCCCCCGTCCGTTTGGG
CACGCCCTCAGGCTGCCGAGCGACGTATTCGTTTTTTGA
 Primer design