SecReT6
Protein ID: 172062688
SecReT6 ID270
T6SS typei2
Gene symbol-
Locus tagBamMC406_3656
StrainBurkholderia ambifaria MC40-6
Repliconchromosome II [GenBank: NC_010552] [Browse all T6SS(s) in this replicon]
Location [Strand]610965..612548 [+]
Producttype VI secretion-associated protein
NoteTssA
UniProt IDB1Z0K2
KEGG IDbac:BamMC406_3656
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.30E-21, Aligned region: 66..124
ImpA-rel_N [PF06812], Evalue: 3.30E-21, Aligned region: 399..413
Protein Sequence: 527 a.a.     [Download]
>gi|172062688|ref|YP_001810339.1| type VI secretion-associated protein [Burkholderia ambifaria MC40-6]
MTLANFVKTLVGGPRIDSLRKARTDTWAAWVAPIPGEHACGRDPGYEDAFFELKDEAGKLSGIDDGMIVR
VCEHLLKETGKDLRVAGYYAFARLRQDGPAGFADGLELAAALVDRFGEALLPARHEAKKAALEMLATARV
IETLDSRGDFAPADLERALAALDVLVTHTAAWPEAARPNLQSLVSRFEKKEGPARSVDAGVAIPPVTAAG
KTSAGSIASTRDLLDQARAMSAWLRDQENGYLPSVRLVRSIRWDTVHDVPPSDAASHTRLAPPRAELRQQ
MKRLVLQKHWHELLERVEGAFMEGVNHLWFDLQYFQHIGLDHVGTPYSAWRELLRTDFALFLERLPGIER
LAFSDGTPFADDTTLEWIARHAVVRDLEAGETVAPLPVSADSASDAAGDWPEIETQARELAARDGIETAF
AWLEALPGMKTDRHRYLQRLVMARLADHAGRHDAALALLAELDGTSRSLTLMRWEPALTFEVKQQLVKAL
KAMSSRKDADKPAFARRIGELQAELTVLDPARALTLS
 
Nucleotide Sequence: 1584 bp     [Download]
>gi|172062142|ref|NC_010552.1|:610965-612548 Burkholderia ambifaria MC40-6 chromosome 2, complete sequence
ATGACGCTTGCCAATTTTGTGAAGACACTCGTCGGTGGTCCCCGCATCGATTCGCTCCGCAAGGCACGGA
CGGATACCTGGGCCGCATGGGTCGCGCCGATACCGGGCGAGCACGCATGCGGGCGCGACCCCGGCTACGA
AGACGCGTTCTTCGAACTGAAGGATGAAGCCGGCAAGCTGTCGGGAATCGATGACGGCATGATCGTCCGC
GTGTGCGAACACCTGCTCAAGGAGACCGGCAAGGATTTGCGCGTCGCCGGCTACTACGCGTTCGCACGCC
TGCGGCAGGACGGCCCGGCCGGGTTTGCCGACGGGCTCGAACTGGCTGCTGCGCTCGTCGACCGGTTTGG
CGAAGCTCTTTTGCCTGCCCGTCACGAAGCGAAGAAGGCCGCGCTCGAAATGCTCGCGACTGCGCGCGTG
ATCGAGACGCTGGATAGTCGTGGCGACTTTGCGCCGGCCGATCTCGAACGCGCGTTGGCCGCGCTCGATG
TGCTCGTCACGCATACGGCGGCGTGGCCCGAGGCGGCTCGCCCGAATTTGCAGTCGCTCGTTTCCCGCTT
CGAGAAAAAGGAAGGGCCGGCACGCAGTGTCGATGCCGGTGTCGCGATACCGCCCGTTACGGCCGCGGGA
AAGACTTCAGCCGGATCGATCGCGTCTACGCGCGATCTGCTCGATCAGGCGCGGGCGATGTCGGCGTGGC
TCAGGGATCAGGAAAACGGCTATTTGCCGTCGGTGCGGCTCGTGCGAAGCATCCGCTGGGACACCGTGCA
CGACGTGCCGCCGTCGGATGCCGCGTCGCATACGCGTCTGGCGCCGCCACGTGCCGAATTGCGTCAGCAG
ATGAAGCGCCTCGTTCTGCAGAAGCACTGGCACGAGTTGCTGGAGCGTGTCGAGGGTGCGTTCATGGAAG
GCGTGAATCACCTGTGGTTCGACCTGCAGTATTTCCAGCACATTGGGCTCGACCACGTCGGCACACCGTA
CAGCGCATGGCGTGAATTGCTGCGCACCGACTTTGCGCTGTTTCTCGAACGACTGCCGGGCATCGAACGG
CTGGCATTCAGCGACGGCACGCCGTTCGCCGACGACACGACGCTCGAATGGATCGCCCGGCATGCGGTCG
TGCGCGATCTGGAAGCGGGCGAGACGGTCGCGCCGCTGCCCGTTTCCGCGGATAGCGCGAGCGATGCGGC
GGGCGACTGGCCGGAGATCGAAACCCAGGCTCGCGAACTGGCTGCCCGTGACGGCATCGAAACGGCCTTT
GCGTGGCTCGAAGCGCTGCCCGGCATGAAAACCGATCGACATCGCTATTTGCAGCGGCTCGTGATGGCCC
GCCTGGCCGACCATGCCGGCCGTCACGATGCGGCGCTCGCACTCCTTGCAGAACTCGACGGAACGTCCCG
TTCGCTGACATTGATGCGCTGGGAGCCGGCGCTGACGTTTGAGGTCAAGCAGCAACTGGTCAAAGCACTG
AAAGCGATGAGCAGCCGCAAGGACGCCGACAAGCCGGCGTTCGCACGCCGCATCGGCGAGCTGCAGGCGG
AACTCACGGTACTCGATCCCGCCCGCGCGTTGACCCTTTCGTAA
 Primer design